Report for 4826.m00289

 > 4826.m00289, length: 714, copies: 1 

MGRGSEMHGQCLFIIVFLIHSVHVLPGCIAQSSDEQTLLAFKAAISGDPNGVLDTWVTTKGSMNATDSICRWRGV

SCRSRQHPGRVTALELMSSNLMGVISPSLSNLSFLHTLNLSGNRLTGGIPLELGQLPRIRVISLGGNSLIGNIPV

SLTNCARLTHLELPRNGLHGEIPANFSNCRELRVFNISANSLSGGIPASFGSLSKLEFLGLHRSNLIGGIPPSLG

NMSSLLAFDASENSNLGGSIPDTLGRLTKLNFLRLAFAGLGGAIPFSLYNISSLTVLDLGNNDLSGMLPPDFGIT

LPRIQFLNLYNCRLQGSIPPSIGNATKLRRIQLQSNGLQGIVPPDIGRLKDLDKLNLQFNQLEDKWDKDWPLMAA

LGNCSRLFALSLSSNKFEGDLPASLVNLTIGIEKIFMNENRISGAIPSEIGKFRNLDVLALADNALTGTIPDTIG

GLSSMTGLDVSGNNISGEIPPMLVANLSKLAFLDLSENDMEGSIPLSFERMSSIAILDLSYNQFSGMLPKQVLSL

SSLTLFLNLSHNTFSGPIPSEVGRLSSLGVLDLSNNRLSGEIPQALAGCQSMEYLFLQGNQFGGRIPQSLVSLKG

LQHLDMSQNNLSGPIPDFLATFQYLRYLNLSYNQLDGPVPTTGVFNATKDFFVGGNRVCGGVSELQLPKCPDRAV

LRLALQCTEDSPRARMLTGYVIRELISVRNTYEDTVDYP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	109	132	0.0075
LRR [Pfam ls]	157	180	0.22
LRR [Pfam ls]	181	204	0.35
LRR [Pfam ls]	205	228	1.3
LRR [Pfam ls]	278	302	0.019
LRR [Pfam ls]	303	326	0.015
LRR [Pfam ls]	327	350	0.32
LRR [Pfam ls]	381	404	4.5
LRR [Pfam ls]	430	453	0.49
LRR [Pfam ls]	454	478	0.045
LRR [Pfam ls]	479	502	0.85
LRR [Pfam ls]	503	527	3.3
LRR [Pfam ls]	552	575	0.016
LRR [Pfam ls]	576	599	4.1
LRR [Pfam ls]	600	623	0.017
LRR [Pfam ls]	624	646	5.2

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	85	108	2.4
LRR [sensitive, ls]	85	108	55
LRR [sensitive, ls]	109	132	0.00033
LRR [sensitive, ls]	109	132	0.0075
LRR [sensitive, ls]	133	156	0.46
LRR [sensitive, ls]	133	156	10
LRR [sensitive, ls]	157	180	0.0099
LRR [sensitive, ls]	157	180	0.22
LRR [sensitive, ls]	181	204	0.016
LRR [sensitive, ls]	181	204	0.35
LRR [sensitive, ls]	205	228	0.058
LRR [sensitive, ls]	205	228	1.3
LRR [sensitive, ls]	229	253	1.3
LRR [sensitive, ls]	229	253	29
LRR [sensitive, ls]	278	302	0.00086
LRR [sensitive, ls]	278	302	0.019
LRR [sensitive, ls]	303	326	0.00067
LRR [sensitive, ls]	303	326	0.015
LRR [sensitive, ls]	327	350	0.014
LRR [sensitive, ls]	327	350	0.32
LRR [sensitive, ls]	351	380	3.6
LRR [sensitive, ls]	351	380	82
LRR [sensitive, ls]	381	404	0.2
LRR [sensitive, ls]	381	404	4.5
LRR [sensitive, ls]	406	429	0.58
LRR [sensitive, ls]	406	429	13
LRR [sensitive, ls]	430	453	0.022
LRR [sensitive, ls]	430	453	0.49
LRR [sensitive, ls]	454	478	0.002
LRR [sensitive, ls]	454	478	0.045
LRR [sensitive, ls]	479	502	0.038
LRR [sensitive, ls]	479	502	0.85
LRR [sensitive, ls]	503	527	0.15
LRR [sensitive, ls]	503	527	3.3
LRR [sensitive, ls]	528	551	1.5
LRR [sensitive, ls]	528	551	34
LRR [sensitive, ls]	552	575	0.00073
LRR [sensitive, ls]	552	575	0.016
LRR [sensitive, ls]	576	599	0.18
LRR [sensitive, ls]	576	599	4.1
LRR [sensitive, ls]	600	623	0.00076
LRR [sensitive, ls]	600	623	0.017
LRR [sensitive, ls]	624	646	0.23
LRR [sensitive, ls]	624	646	5.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	32	670	1e-120
CLV2 [A. thaliana]	34	682	2e-62
FLS2 [A.thaliana]	36	642	6e-84
Cf-9 [L. pimpinellifolium]	37	679	5e-55
FLS2 [A.thaliana]	85	363	3e-32
Cf-9 [L. pimpinellifolium]	86	695	8e-48
FLS2 [A.thaliana]	88	609	6e-73
CLV2 [A. thaliana]	89	428	2e-26
FLS2 [A.thaliana]	94	666	6e-82
FLS2 [A.thaliana]	94	664	1e-80
CLV2 [A. thaliana]	100	469	9e-29
N [N. glutinosa]	295	569	5e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4826.m00289

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)