Report for 4849.m00166

 > 4849.m00166, length: 1024, copies: 1 

MKIAATGQFLLVLMACSVIQIVCQSLHGNETDRLSLLDFKNAIILDPQQALVSWNDSNQVCSWEGVFCRVKAPNH

VVALNLTNRDLVGTISPSLGNLTFLKHLNLTGNAFTGQIPASLAHLHRLQTLSLASNTLQGRIPNLANYSDLMVL

DLYRNNLAGKFPADLPHSLEKLRLSFNNIMGTIPASLANITRLKYFACVNTSIEGNIPDEFSKLSALKFLHLGIN

KLTGSFPEAVLNISALTELSFAINDLHGEVPPDLGNSLPNLQAFELGGNHFNGKIPSSITNASNLYLIDVSNNNF

SGGLASSIGKLTKLSWLNLEENKLHGRNNEDQEFLNSIANCTELQMFSISWNRLEGRLPNSFGNHSFQLQYVHMG

QNQLSGQFPSGLTNLHNLVVIELSGNRFSGVLPDWLGALKSLQKLTVGDNNFTGLIPSSLFNLTNLVHLFLYSNK

FSGQLPASFGNLEALERLGISNNNFDGTVPEDIFRIPTIQYIDLSFNNLEGLLPFYVGNAKHLIYLVLSSNNLSG

EIPNTLGNSESLQIIKFDHNIFTGGIPTSLGKLLSLTLLNLSYNNLTGPIPDSLSNLKYLGQLDFSFNHLNGEVP

TKGIFKNATAIQLGGNQGLCGGVLELHLPACSIAPLSSRKHVKSLTIKIVIPLAILVSLFLVVLVLLLLRGKQKG

HSISLPLSDTDFPKVSYNDLARATERFSMSNLIGKGRFSCVYQGKLFQCNDVVAVKVFSLETRGAQKSFIAECNA

LRNVRHRNLVPILTACSSIDSKGNDFKALVYKFMPGGDLHKLLYSNGGDGDAPHQNHITLAQRINIMVDVSDALE

YLHHSNQGTIVHCDLKPSNILLDDNMVAHVGDFGLARFKFDSTTSSLSYLNSTSSLVIKGTIGYIAPECSDGGQV

STASDVYSFGVVLLEIFIRRRPTDDMFMDGLSIAKYTAINFPDRILEIVDPKLQQELIPCSTDKEDLDPCQENPI

AVEEKGLHCLRSMLNIGLCCTKPTPGERISMQEVAAKLHRIKDAYLREY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	99	122	0.059
LRR [Pfam ls]	123	145	1.5
LRR [Pfam ls]	168	191	0.086
LRR [Pfam ls]	289	312	0.24
LRR [Pfam ls]	368	391	2.7
LRR [Pfam ls]	392	415	0.0076
LRR [Pfam ls]	416	439	0.02
LRR [Pfam ls]	440	463	0.028
LRR [Pfam ls]	488	511	2.2
LRR [Pfam ls]	512	535	0.79
LRR [Pfam fs]	560	583	7.9e-06
LRR [Pfam ls]	560	583	0.00012
Ser/Thr pkinase [Pfam fs]	702	929	1.2e-50
Ser/Thr pkinase [Pfam ls]	702	1009	5.7e-46

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	75	98	1.1
LRR [sensitive, ls]	75	98	12
LRR [sensitive, ls]	99	122	0.0054
LRR [sensitive, ls]	99	122	0.059
LRR [sensitive, ls]	123	145	0.14
LRR [sensitive, ls]	123	145	1.5
LRR [sensitive, ls]	146	166	0.91
LRR [sensitive, ls]	146	166	10
LRR [sensitive, ls]	168	191	0.0078
LRR [sensitive, ls]	168	191	0.086
LRR [sensitive, ls]	192	215	6.4
LRR [sensitive, ls]	192	215	70
LRR [sensitive, ls]	216	239	1.6
LRR [sensitive, ls]	216	239	17
LRR [sensitive, ls]	240	264	0.74
LRR [sensitive, ls]	240	264	8.1
LRR [sensitive, ls]	265	288	0.73
LRR [sensitive, ls]	265	288	8
LRR [sensitive, ls]	289	312	0.022
LRR [sensitive, ls]	289	312	0.24
LRR [sensitive, ls]	313	342	3.8
LRR [sensitive, ls]	313	342	42
LRR [sensitive, ls]	343	366	0.82
LRR [sensitive, ls]	343	366	9
LRR [sensitive, ls]	368	391	0.24
LRR [sensitive, ls]	368	391	2.7
LRR [sensitive, ls]	392	415	0.00069
LRR [sensitive, ls]	392	415	0.0076
LRR [sensitive, ls]	416	439	0.0019
LRR [sensitive, ls]	416	439	0.02
LRR [sensitive, ls]	440	463	0.0026
LRR [sensitive, ls]	440	463	0.028
LRR [sensitive, ls]	464	487	0.53
LRR [sensitive, ls]	464	487	5.8
LRR [sensitive, ls]	488	511	0.2
LRR [sensitive, ls]	488	511	2.2
LRR [sensitive, ls]	512	535	0.072
LRR [sensitive, ls]	512	535	0.79
LRR [sensitive, ls]	536	559	0.81
LRR [sensitive, ls]	536	559	8.9
LRR [sensitive, ls]	560	583	1.1e-05
LRR [sensitive, ls]	560	583	0.00012
LRR [sensitive, ls]	584	609	6.1
LRR [sensitive, ls]	584	609	66

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	9	602	1e-58
CLV2 [A. thaliana]	32	620	5e-59
Xa21 [O. sativa]	32	815	1e-158
Cf-9 [L. pimpinellifolium]	35	334	4e-18
FLS2 [A.thaliana]	35	617	4e-86
FLS2 [A.thaliana]	35	245	5e-13
Cf-9 [L. pimpinellifolium]	74	630	5e-51
FLS2 [A.thaliana]	74	230	2e-16
FLS2 [A.thaliana]	78	1017	1e-129
CLV2 [A. thaliana]	172	634	2e-44
Cf-9 [L. pimpinellifolium]	377	616	9e-18
Pto [L. esculentum]	676	964	1e-23
Rpg1 [Hordeum vulgare]	691	916	9e-20
Rpg1 [Hordeum vulgare]	699	916	2e-16

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	649	668	out -> in

Report for 4849.m00166

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)