Report for 4849.m00174

 > 4849.m00174, length: 666, copies: 1 

MAYNRLEGHLPSSLSNFSAHLQRLHLGGNAISESFPSGIEHLSNLIALSVGTNDFTGTLPEWLGNLKQLQILSLY

DNYFTGFIPSSLSNLSQLVALTLQFNKLDGQIPSLGNQLQMLQIFNVLYNNLHGVIPNAIFSLPSLIQVDLSYNN

LHGQLPIDIGNAKQLVSLKLSSNKLSGDILNALGDCESLEVIRLDRNNFSGSIPISLGNISSLRVLNLSLNNLTG

SIPVSLSNLQYLEKLNLSFNHLKGEIPAKGIFKNATAFQIDGNQGLCGGPPALHLTTCPIVPLVSSKHNNLILLK

VMIPLACMVSLATVISIIFIWRAKLKRESVSLPFFGSNFPRISYNALFKATEGFSTSSLIGRGRYGSVFVGKLFQ

ENNVVAVKVFSLETRGAGKSFIAECNALRNVRHRNIVPILTACSSIDSKGNDFKALVYEFMSQGDLYNLLYTTRH

DSNSSKLNHISLAQRTSIVLDVSSALEYLHHNNQGTIVHCDLNPSNILLDKNMIAHVGDFGLARFKIDSSSPSLG

DSNLTSSLATRGTIGYIAPECSEGGQVSTASDVFSFGVVLLELFIRRRPIDDMFKDGLSIAKHVEMNFPDRILEI

VDPQVQHELDLCQETPMAVKEKGIHCLRSVLNIGLCCTNPTPSERISMQEAAAKLHGINDSYLRGN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	20	43	0.046
LRR [Pfam ls]	68	91	0.0028
LRR [Pfam ls]	140	163	3.9
LRR [Pfam ls]	164	187	4
LRR [Pfam ls]	188	211	1.2
LRR [Pfam ls]	212	235	0.026
LRR [Pfam ls]	236	260	3.6
Ser/Thr pkinase [Pfam fs]	354	574	1.1e-47
Ser/Thr pkinase [Pfam ls]	354	657	9.6e-46

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	20	43	0.0042
LRR [sensitive, ls]	20	43	0.046
LRR [sensitive, ls]	44	67	0.58
LRR [sensitive, ls]	44	67	6.4
LRR [sensitive, ls]	68	91	0.00026
LRR [sensitive, ls]	68	91	0.0028
LRR [sensitive, ls]	92	115	1.7
LRR [sensitive, ls]	92	115	18
LRR [sensitive, ls]	116	139	4.4
LRR [sensitive, ls]	116	139	49
LRR [sensitive, ls]	140	163	0.36
LRR [sensitive, ls]	140	163	3.9
LRR [sensitive, ls]	164	187	0.37
LRR [sensitive, ls]	164	187	4
LRR [sensitive, ls]	188	211	0.11
LRR [sensitive, ls]	188	211	1.2
LRR [sensitive, ls]	212	235	0.0024
LRR [sensitive, ls]	212	235	0.026
LRR [sensitive, ls]	236	260	0.33
LRR [sensitive, ls]	236	260	3.6

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	1	253	1e-30
CLV2 [A. thaliana]	1	280	4e-27
CLV2 [A. thaliana]	1	296	2e-26
CLV2 [A. thaliana]	1	276	2e-16
FLS2 [A.thaliana]	1	662	2e-84
FLS2 [A.thaliana]	1	276	2e-33
Xa21 [O. sativa]	1	144	2e-13
FLS2 [A.thaliana]	3	296	6e-39
Cf-9 [L. pimpinellifolium]	4	275	4e-28
Cf-9 [L. pimpinellifolium]	4	253	7e-18
CLV2 [A. thaliana]	4	203	8e-17
FLS2 [A.thaliana]	4	296	4e-37
Xa21 [O. sativa]	4	242	4e-29
Cf-9 [L. pimpinellifolium]	5	251	2e-29
FLS2 [A.thaliana]	5	251	1e-37
CLV2 [A. thaliana]	6	252	2e-29
Xa21 [O. sativa]	8	467	2e-98
N [N. glutinosa]	10	170	8e-11
Cf-9 [L. pimpinellifolium]	15	296	3e-21
CLV2 [A. thaliana]	24	277	2e-21
Xa21 [O. sativa]	38	252	1e-27
CLV2 [A. thaliana]	43	277	2e-12
FLS2 [A.thaliana]	44	254	2e-25
Xa21 [O. sativa]	141	253	3e-14
Xa21 [O. sativa]	164	253	1e-10
Rpg1 [Hordeum vulgare]	333	568	2e-17
Pto [L. esculentum]	341	627	6e-23
Rpg1 [Hordeum vulgare]	343	568	3e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	301	323	in -> out

Report for 4849.m00174

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)