Report for 4849.m00177

 > 4849.m00177, length: 1014, copies: 2 

MMVITTGKIILIFLACTAHVVTCSSLYGNETDRVALLEFKQAVCLDPKQTLMSWNDSIHFCNWEGILCSLRIPYR

VTSLNLTNRGLVGQISPSLGNLTFLSILSLTENSFSGQIPASLGHLNHLQTLWLSNNTLQGVIPDFTNCSSMKAL

RLNGNNLVGKFPQLPHRLQSLQLSYNHLSGTIPASLANITRLNVLTCTYNNIQGDIPHEIGKLSSLQFLYVGANK

LVGRFPQAILNLSTLIGLSLGFNNLTGEAPSNLGNCLPNLQLLELEDNCFQGQIPSSLINASKLYRLELASNNFT

GVVPRSIGKLTKLSWLNLQSNKLQARNKQDWEFLDSLANCTELKAFSIASNHLEGHVPTSLGNLSVQLVQLFLSG

NQLSGGFPSGIANLPNLIYIGLDNNQFTGAVPKWLGTLSNLQQILLHENMFTGFIPTSLSNLSVLGSLWLDYNKI

GGPLPASLGNLQTLETLSISNNKLHGSVPMEIFRIPTIRLIDLSFNNFDGQLSARVGNAKQLMYLYLSSNNLSGD

IPSSLGNCESLEGIKLGSNILSGSIPTSLGNIRSLKVLNLSHNNLSGSIHANLGKLWLLEQVDLSFNNLSGEIPT

EGIFLNATAVHINGNEGLCGGALNLHLPTCYVMPLNSSRSERSILLYLVILFASLVSVIFIYLLLLWRGKQKKKC

TSLTPFDSKFPKVSYNDLAKATEGFSASNIIGRGIYSHVYKGELFQGRDVVAVKVFSLETEGAEHSFITECNALR

KVRHRNLVPILTVCSSLDTKGNDFRALVYKLIPQGDLYSLLHSTRDSENGFTSNIITFSQRLSIVVDIADALEYL

HHNNQETVVHCDIKPSNILLDNDMKAYVGDFGLARLKADAAVPSVGDSNSTSMIAIKGTIGYVAPEYASGGQVST

AADVYSFGIVLLEVFLRKGPTDDMFKDGLDIAKFVSMNFPDKILDIVDPVLLQDELDCSKESPVAMKEIFSEGLH

SVLNIGLCCTKQSPYERMDMREVAAKLHGTRRHISEATR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	99	122	4.9
LRR [Pfam ls]	123	145	0.0039
LRR [Pfam ls]	167	190	0.016
LRR [Pfam ls]	191	214	3.7
LRR [Pfam ls]	264	287	0.63
LRR [Pfam ls]	288	311	0.17
LRR [Pfam ls]	367	390	0.019
LRR [Pfam ls]	391	414	3.6
LRR [Pfam ls]	415	438	0.14
LRR [Pfam ls]	463	486	5.3
LRR [Pfam ls]	511	534	0.11
LRR [Pfam ls]	559	582	0.0074
Ser/Thr pkinase [Pfam fs]	700	923	2.5e-46
Ser/Thr pkinase [Pfam ls]	700	1004	1.4e-41

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	75	98	0.71
LRR [sensitive, ls]	75	98	7.8
LRR [sensitive, ls]	99	122	0.45
LRR [sensitive, ls]	99	122	4.9
LRR [sensitive, ls]	123	145	0.00036
LRR [sensitive, ls]	123	145	0.0039
LRR [sensitive, ls]	146	165	4.3
LRR [sensitive, ls]	146	165	47
LRR [sensitive, ls]	167	190	0.0014
LRR [sensitive, ls]	167	190	0.016
LRR [sensitive, ls]	191	214	0.33
LRR [sensitive, ls]	191	214	3.7
LRR [sensitive, ls]	215	238	0.79
LRR [sensitive, ls]	215	238	8.6
LRR [sensitive, ls]	239	263	0.75
LRR [sensitive, ls]	239	263	8.3
LRR [sensitive, ls]	264	287	0.057
LRR [sensitive, ls]	264	287	0.63
LRR [sensitive, ls]	288	311	0.015
LRR [sensitive, ls]	288	311	0.17
LRR [sensitive, ls]	312	341	1.2
LRR [sensitive, ls]	312	341	13
LRR [sensitive, ls]	342	365	1.9
LRR [sensitive, ls]	342	365	20
LRR [sensitive, ls]	367	390	0.0017
LRR [sensitive, ls]	367	390	0.019
LRR [sensitive, ls]	391	414	0.33
LRR [sensitive, ls]	391	414	3.6
LRR [sensitive, ls]	415	438	0.013
LRR [sensitive, ls]	415	438	0.14
LRR [sensitive, ls]	439	462	1.2
LRR [sensitive, ls]	439	462	13
LRR [sensitive, ls]	463	486	0.49
LRR [sensitive, ls]	463	486	5.3
LRR [sensitive, ls]	487	510	1.6
LRR [sensitive, ls]	487	510	17
LRR [sensitive, ls]	511	534	0.01
LRR [sensitive, ls]	511	534	0.11
LRR [sensitive, ls]	535	558	1.3
LRR [sensitive, ls]	535	558	14
LRR [sensitive, ls]	559	582	0.00067
LRR [sensitive, ls]	559	582	0.0074
LRR [sensitive, ls]	583	607	1
LRR [sensitive, ls]	583	607	11

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	24	624	1e-52
Cf-9 [L. pimpinellifolium]	30	599	1e-56
FLS2 [A.thaliana]	30	623	2e-83
CLV2 [A. thaliana]	32	644	2e-52
Xa21 [O. sativa]	32	813	1e-158
FLS2 [A.thaliana]	78	1002	1e-130
FLS2 [A.thaliana]	86	599	3e-76
Cf-9 [L. pimpinellifolium]	224	644	2e-34
Rpg1 [Hordeum vulgare]	669	918	5e-19
Pto [L. esculentum]	670	1002	1e-24
Rpg1 [Hordeum vulgare]	674	918	8e-22

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	644	666	out -> in

Report for 4849.m00177

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)