Report for 4914.m00059

 > 4914.m00059, length: 582, copies: 1 

MGAVCSRKRSQLVHEDDSFQTSSRFSKTSSLKWLLLTLPRSNSDVSRKGQGKGPGRCPSLMELCVAKACEDINKY

SSFSVLPRDLSQQIFNELVASNRLTETLLETFRDCALQDIDLGEYPGVNDAWMEVVASQRHSLLSVDISCSEITD

SGLYLLRDCPNMQSLACNYCDMISEHGLGILSGLSNLTSLSFKSSDGITAEAMEAFANLVNLVNLDLERCLKIHG

GLVHLKGLRNLESLNMRYCNNIADSDIKYLSDLTNLKELQLACCRITDLGVSYLRGLSKLTQLNLEGCPVTAACL

EAISGLASLVVLNLSRCGIYGEGCENFQGLKKLKVLNLGFNNITDDCLAHLKELINLESLNLDSCKVGDEGLLHL

RGLMLLKSLELSDTEVGSSGLQHLSGLRNLESINLSFTLVTDTGMKKISALNSLKSVNLDNRQITDVGLAALTSL

TGLTHLDLFGARITDYGTSCFRFFKNLESLEVCGGLITDAGVKNIKDLKALKQLNLSQNVNLTDKTLELISGLTA

LVSLNVSNTRVSNAGLRHLKDLQNLRSLSLDSCRVTTSEVKKLQATVLPNLISVRPE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	260	283	0.083
LRR [Pfam ls]	284	307	8.8
LRR [Pfam ls]	332	355	3.1
LRR [Pfam ls]	500	524	6.7

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	137	160	1.9
LRR [sensitive, ls]	137	160	40
LRR [sensitive, ls]	211	234	0.55
LRR [sensitive, ls]	211	234	11
LRR [sensitive, ls]	235	259	0.75
LRR [sensitive, ls]	235	259	16
LRR [sensitive, ls]	260	283	0.004
LRR [sensitive, ls]	260	283	0.083
LRR [sensitive, ls]	284	307	0.42
LRR [sensitive, ls]	284	307	8.8
LRR [sensitive, ls]	308	331	0.71
LRR [sensitive, ls]	308	331	15
LRR [sensitive, ls]	332	355	0.15
LRR [sensitive, ls]	332	355	3.1
LRR [sensitive, ls]	356	379	0.84
LRR [sensitive, ls]	356	379	17
LRR [sensitive, ls]	380	403	1
LRR [sensitive, ls]	380	403	21
LRR [sensitive, ls]	404	427	1.7
LRR [sensitive, ls]	404	427	35
LRR [sensitive, ls]	428	451	0.62
LRR [sensitive, ls]	428	451	13
LRR [sensitive, ls]	452	475	0.99
LRR [sensitive, ls]	452	475	21
LRR [sensitive, ls]	476	499	2.4
LRR [sensitive, ls]	476	499	51
LRR [sensitive, ls]	500	524	0.32
LRR [sensitive, ls]	500	524	6.7
LRR [sensitive, ls]	525	548	1.6
LRR [sensitive, ls]	525	548	32
LRR [sensitive, ls]	549	577	0.55
LRR [sensitive, ls]	549	577	11

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	184	572	8e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4914.m00059

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)