Report for 4931.m00052

 > 4931.m00052, length: 627, copies: 1 

MAGNVIRLELSEASLGGQVLQGRMSPSLASLEHLEYLDLSALVLPGINSSSPKFLGSMTNLRYLDLSGCFLSGSV

SPWLGNLSKLEYLDLSFSTLSGRVPPELGNLTRLKHLDLGNMQHMYSADISWITHLRSLEYLDMSLVNLLNTIPS

LEVLNLVKFTLPSTPQALAQLNLTKLVQLDLSSNRLGHPIQSCWFWNLTSIESLELSETFLHGPFPTALGSFTAL

QWLGFSDNGNAATLLADMRSLCSMKSLGLGGSLSHGNIEDLVDRLPHGITRDKPAQEGNFTSLSYLDLSDNHLAG

IIPSDIAYTIPSLCHLDLSRNNLTGPIPIIENSSLSELILRSNQLTGQIPKLDRKIEVMDISINLLSGPLPIDIG

SPNLLALILSSNYLIGRIPESVCESQSMIIVDLSNNFLEGAFPKCFQMQRLIFLLLSHNSFSAKLPSFLRNSNLL

SYVDLSWNKFSGTLPQWIGHMVNLHFLHLSHNMFYGHIPIKITNLKNLHYFSLAANNISGAIPRCLSKLTMMIGK

QSTIIEIDWFHAYFDVVDGSLGRIFSVVMKHQEQQYGDSILDVVGIDLSLNSLTGGIPDEITSLKRLLSLNLSWN

QLSGEIVEKIGAMNSLESLDLSRNKFS

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	60	83	0.0019
LRR [Pfam ls]	84	107	0.011
LRR [Pfam ls]	175	199	0.32
LRR [Pfam ls]	287	310	0.99
LRR [Pfam ls]	312	333	4.1
LRR [Pfam ls]	473	496	0.33
LRR [Pfam ls]	497	520	4.1
LRR [Pfam ls]	591	614	5.1

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	33	56	1.4
LRR [sensitive, ls]	33	56	15
LRR [sensitive, ls]	60	83	0.00017
LRR [sensitive, ls]	60	83	0.0019
LRR [sensitive, ls]	84	107	0.001
LRR [sensitive, ls]	84	107	0.011
LRR [sensitive, ls]	108	132	7.3
LRR [sensitive, ls]	108	132	80
LRR [sensitive, ls]	133	155	3.5
LRR [sensitive, ls]	133	155	38
LRR [sensitive, ls]	175	199	0.03
LRR [sensitive, ls]	175	199	0.32
LRR [sensitive, ls]	200	223	0.75
LRR [sensitive, ls]	200	223	8.3
LRR [sensitive, ls]	287	310	0.09
LRR [sensitive, ls]	287	310	0.99
LRR [sensitive, ls]	312	333	0.37
LRR [sensitive, ls]	312	333	4.1
LRR [sensitive, ls]	334	356	1.4
LRR [sensitive, ls]	334	356	16
LRR [sensitive, ls]	378	401	2.5
LRR [sensitive, ls]	378	401	28
LRR [sensitive, ls]	402	424	2.5
LRR [sensitive, ls]	402	424	28
LRR [sensitive, ls]	425	448	0.61
LRR [sensitive, ls]	425	448	6.7
LRR [sensitive, ls]	449	472	0.82
LRR [sensitive, ls]	449	472	9
LRR [sensitive, ls]	473	496	0.03
LRR [sensitive, ls]	473	496	0.33
LRR [sensitive, ls]	497	520	0.37
LRR [sensitive, ls]	497	520	4.1
LRR [sensitive, ls]	567	590	1.1
LRR [sensitive, ls]	567	590	13
LRR [sensitive, ls]	591	614	0.47
LRR [sensitive, ls]	591	614	5.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	3	627	6e-52
CLV2 [A. thaliana]	3	627	2e-45
FLS2 [A.thaliana]	3	624	5e-54
Cf-9 [L. pimpinellifolium]	4	604	7e-29
FLS2 [A.thaliana]	4	513	8e-44
Xa21 [O. sativa]	5	626	3e-40
FLS2 [A.thaliana]	9	624	5e-57
Cf-9 [L. pimpinellifolium]	10	522	4e-33
Cf-9 [L. pimpinellifolium]	39	489	2e-27
CLV2 [A. thaliana]	175	627	2e-33
FLS2 [A.thaliana]	420	627	4e-14
Xa21 [O. sativa]	425	627	1e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4931.m00052

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)