Report for 4969.m00157

 > 4969.m00157, length: 611, copies: 1 

MVVYSILILFLLLLIFSISNSQSAAQPSADEQTLLLAIKQDWDNPAPLSSWSSTGNWTGVIYNNITGQVTGLSLP

SFHIARPNPPSVCRLKNLTYIDLSFNNLTGDFPTVLYGCSALEFLDLSNNQLSGKLPDRIDRLSLGMQHLNLSSN

AFTGDVPLAIGRFSKLKSLVLDTNSFNGNYPGAAIGGLLELETLTLAKNPFEPGPVPKEFGNLTKLKLLWLSCMN

MTGTIPDDLSSLTELTLLDLSQNKMQGQIPEWVLKHQKLENLYLYASNLSGEIGPNITALNLQELDLSMNKFSGS

IPEDIANLKKLRLLFLYYNNLTGPIPAGVGMMPNLTDIRLFNNKLSGPLPAELGKHSELGNFEVSNNNLSGELPD

TLCFNKKLFDIVVFNNSFSGVFPTNLGDCKTINNIMAYNNHFVGDFPKKIWSFELLTNVMIYNNFTGTLPSEISF

NILRIEMGNNRFSGALPSAAVGLKSFTAENNQFSGELPTDMSRLANLTMLNLAGNQLLTTVKIYINNFASTLPSN

KIVSITTNKILQMLLNATTPVGRLAEGELEAGPAAALLLSLINFFTGQRPKQSTGVTRSSVLVLLAVKFTHVHVL

EQMALVSADTN

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	92	115	0.066
LRR [Pfam ls]	116	139	0.04
LRR [Pfam ls]	141	164	5.7
LRR [Pfam ls]	190	214	7.3
LRR [Pfam ls]	215	238	0.64
LRR [Pfam ls]	239	260	4.9
LRR [Pfam ls]	286	309	0.016
LRR [Pfam ls]	310	333	2.2

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	92	115	0.0032
LRR [sensitive, ls]	92	115	0.066
LRR [sensitive, ls]	116	139	0.0019
LRR [sensitive, ls]	116	139	0.04
LRR [sensitive, ls]	141	164	0.27
LRR [sensitive, ls]	141	164	5.7
LRR [sensitive, ls]	165	189	3.6
LRR [sensitive, ls]	165	189	75
LRR [sensitive, ls]	190	214	0.35
LRR [sensitive, ls]	190	214	7.3
LRR [sensitive, ls]	215	238	0.031
LRR [sensitive, ls]	215	238	0.64
LRR [sensitive, ls]	239	260	0.24
LRR [sensitive, ls]	239	260	4.9
LRR [sensitive, ls]	263	283	0.74
LRR [sensitive, ls]	263	283	15
LRR [sensitive, ls]	286	309	0.00078
LRR [sensitive, ls]	286	309	0.016
LRR [sensitive, ls]	310	333	0.1
LRR [sensitive, ls]	310	333	2.2
LRR [sensitive, ls]	334	357	0.49
LRR [sensitive, ls]	334	357	10
LRR [sensitive, ls]	358	382	1.3
LRR [sensitive, ls]	358	382	28
LRR [sensitive, ls]	451	474	1.9
LRR [sensitive, ls]	451	474	40
LRR [sensitive, ls]	496	519	0.94
LRR [sensitive, ls]	496	519	20

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	1	467	2e-48
FLS2 [A.thaliana]	5	541	1e-56
Xa21 [O. sativa]	7	537	2e-54
Cf-9 [L. pimpinellifolium]	32	508	6e-36
Cf-9 [L. pimpinellifolium]	50	549	5e-34
FLS2 [A.thaliana]	54	471	6e-46
CLV2 [A. thaliana]	58	333	2e-20
Cf-9 [L. pimpinellifolium]	59	423	2e-29
FLS2 [A.thaliana]	59	507	6e-50
FLS2 [A.thaliana]	60	343	3e-29
Cf-9 [L. pimpinellifolium]	62	534	3e-35
Xa21 [O. sativa]	63	303	3e-19
CLV2 [A. thaliana]	84	571	2e-37
FLS2 [A.thaliana]	84	529	3e-51
Cf-9 [L. pimpinellifolium]	93	328	4e-20
CLV2 [A. thaliana]	112	581	1e-22
FLS2 [A.thaliana]	120	582	5e-49
FLS2 [A.thaliana]	179	595	7e-35
Xa21 [O. sativa]	184	577	3e-33
CLV2 [A. thaliana]	364	590	4e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	2	19	in -> out

Report for 4969.m00157

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)