Report for 4992.m00094

 > 4992.m00094, length: 506, copies: 1 

MMISTKQRLLTPILILLICCYSIVTAANNDTTVPCLPEQASSLLQLKNSFINNANLSSWRAGSDCCHWEGITCGM

ASGRVISLDLSELNLMSNRLDAALFNLTSLTNLNLASNYFWRAELPVSGFERLTDMIHLNFSHSNFYGQIPIGLA

CLMKLVTLDFSSNDGLYFDEPSFQTVMANMSNLRELHLDEIEIFGSTWSVVLADNIPQLEILSLFACRISGPIHS

SFSRLRSLKVINLGYNFGLPSKVPEFCAELSSLSILEIAGNSFEGQFPTKIFHLKSLRTLDLSHNPNLSINLPEF

PDGNNLETLGLAATNLSYHIPSSFANLKSLKRLGMSTARTSKELPSLLDKLPSLTELELQGSESGLEKAVLSWVG

NLKQLTALELVSYDFSESAPSWIGNLTNLKFLWIWDCNFSGSIIPYQIGNLAKLETLDFRGCEFFGQQIPPWIGN

FTKLANLEMDSCGFSGSIPSTIGNLTQLESLRITSNPQLNGKSLYDGYFFLHTYAI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	104	129	4.1
LRR [Pfam ls]	208	231	3.4
LRR [Pfam ls]	281	304	1.2
LRR [Pfam ls]	305	328	2.1
LRR [Pfam ls]	428	452	7.9
LRR [Pfam ls]	453	476	6.9

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	79	103	4.7
LRR [sensitive, ls]	79	103	92
LRR [sensitive, ls]	104	129	0.21
LRR [sensitive, ls]	104	129	4.1
LRR [sensitive, ls]	130	154	7.5
LRR [sensitive, ls]	130	154	150
LRR [sensitive, ls]	208	231	0.17
LRR [sensitive, ls]	208	231	3.4
LRR [sensitive, ls]	232	256	2.2
LRR [sensitive, ls]	232	256	42
LRR [sensitive, ls]	257	280	0.96
LRR [sensitive, ls]	257	280	19
LRR [sensitive, ls]	281	304	0.061
LRR [sensitive, ls]	281	304	1.2
LRR [sensitive, ls]	305	328	0.11
LRR [sensitive, ls]	305	328	2.1
LRR [sensitive, ls]	353	378	3.6
LRR [sensitive, ls]	353	378	71
LRR [sensitive, ls]	379	402	5.7
LRR [sensitive, ls]	379	402	110
LRR [sensitive, ls]	403	427	0.67
LRR [sensitive, ls]	403	427	13
LRR [sensitive, ls]	428	452	0.4
LRR [sensitive, ls]	428	452	7.9
LRR [sensitive, ls]	453	476	0.35
LRR [sensitive, ls]	453	476	6.9
LRR [sensitive, ls]	477	503	7
LRR [sensitive, ls]	477	503	140

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	13	468	1e-35
CLV2 [A. thaliana]	37	486	3e-29
FLS2 [A.thaliana]	39	486	1e-25
Xa21 [O. sativa]	42	486	1e-30
Cf-9 [L. pimpinellifolium]	81	359	6e-11
CLV2 [A. thaliana]	85	406	3e-13
Xa21 [O. sativa]	85	499	1e-22
FLS2 [A.thaliana]	89	499	2e-24
Cf-9 [L. pimpinellifolium]	91	486	1e-15
RPP5 [A. thaliana]	124	478	8e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 4992.m00094

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)