Report for 4992.m00095

 > 4992.m00095, length: 847, copies: 1 

MAGGGSDSAVLEGQRRAQRGWEARVLAEIVFVELLFVFSKIIFAAVGIGKIPQSLFALPRLENVYLQENQLSGSL

EDIPYPLTSSLLCIDLANNQLSGPIPNSLFHLTNLNYLILESNKFTGTVELSSVWKQKNLFILSLSNNLISLIDD

EGTLKYLDAVSLLDLSSNQITGAIPNWIWENWKGHLNILNLSCNMLTTLEQSPSLVNMSNLAYLDLSFNRLQGSI

PIPVTTSSEIALDYSNNHFSSIVPNFGIYLENASYINFSNNKLSGNVPSSICNASKAIITDLSGNNYSGSVPACL

TGSVNLSVLKLRDNQFHGVLPNNSREGCNLQSIDVNGNQIEGKLPRSLSYCQYLELLDAGNNQIVDSFPFWLGKL

PNLRVLVLRSNKLNGTIRGLKGCHQNCNHFKRLQIIDLASNHFSGNIHPEWFEHFQSMMENDNDEGHILEHTTNT

KIPLLYQDITVVNYKGGTLMFTKILTTFKVIDLSDNSFGGPIPKSLGKLVSLRGLNLSHNAFTGHIPSQLNSLTQ

LESLDLSWNKLSGEIPPELASLTSLAWLNLSYNNLTRRIPQGNQFGSFSNSSFEGNVNLCGKPLSKQCDTPGSTS

PSASAPSGTNSFWQDRLGVILLFIFSGLGFTVGFILAVWSSGAIYKQCALCANLCGGPVAHSLEHLVALVVWWWK

KRAMTKQTDRTGHPSSDPLIADCNICLKSATSGTLDTISPSSPPPSSSPPYNLMPHSGEVQVVAVITDWDVRDRL

RWGRRTARGGSLAAAGGGAAAGPPGRHALQPSGRACTMQEREIVPSSPGGWPGEIPALVQTLPPLTRRCTSSIAG

RVAGKAAGGGTWPRPRLVFAAT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	85	108	0.54
LRR [Pfam ls]	159	183	3.6
LRR [Pfam ls]	185	206	5.9
LRR [Pfam ls]	210	234	1.7
LRR [Pfam ls]	329	352	0.59
LRR [Pfam ls]	353	376	7.5
LRR [Pfam ls]	377	399	3.5
LRR [Pfam ls]	407	431	0.13
LRR [Pfam ls]	477	500	2
LRR [Pfam ls]	501	524	0.017
LRR [Pfam fs]	525	548	8.7e-05
LRR [Pfam ls]	525	548	0.0015
LRR [Pfam ls]	549	582	2.7

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	60	83	0.91
LRR [sensitive, ls]	60	83	18
LRR [sensitive, ls]	85	108	0.027
LRR [sensitive, ls]	85	108	0.54
LRR [sensitive, ls]	109	133	1.1
LRR [sensitive, ls]	109	133	22
LRR [sensitive, ls]	134	155	0.95
LRR [sensitive, ls]	134	155	19
LRR [sensitive, ls]	159	183	0.18
LRR [sensitive, ls]	159	183	3.6
LRR [sensitive, ls]	185	206	0.3
LRR [sensitive, ls]	185	206	5.9
LRR [sensitive, ls]	210	234	0.085
LRR [sensitive, ls]	210	234	1.7
LRR [sensitive, ls]	257	280	0.94
LRR [sensitive, ls]	257	280	19
LRR [sensitive, ls]	305	325	1.8
LRR [sensitive, ls]	305	325	35
LRR [sensitive, ls]	329	352	0.03
LRR [sensitive, ls]	329	352	0.59
LRR [sensitive, ls]	353	376	0.38
LRR [sensitive, ls]	353	376	7.5
LRR [sensitive, ls]	377	399	0.18
LRR [sensitive, ls]	377	399	3.5
LRR [sensitive, ls]	407	431	0.0064
LRR [sensitive, ls]	407	431	0.13
LRR [sensitive, ls]	477	500	0.1
LRR [sensitive, ls]	477	500	2
LRR [sensitive, ls]	501	524	0.00086
LRR [sensitive, ls]	501	524	0.017
LRR [sensitive, ls]	525	548	7.6e-05
LRR [sensitive, ls]	525	548	0.0015
LRR [sensitive, ls]	549	582	0.13
LRR [sensitive, ls]	549	582	2.7

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	42	582	1e-41
CLV2 [A. thaliana]	48	625	1e-55
Cf-9 [L. pimpinellifolium]	49	641	2e-87
FLS2 [A.thaliana]	49	593	4e-52
FLS2 [A.thaliana]	49	590	8e-44
Xa21 [O. sativa]	49	586	7e-47
Cf-9 [L. pimpinellifolium]	54	582	3e-29
FLS2 [A.thaliana]	63	566	1e-38
CLV2 [A. thaliana]	84	543	6e-33
CLV2 [A. thaliana]	158	583	2e-30
FLS2 [A.thaliana]	167	567	3e-37
Xa21 [O. sativa]	202	565	2e-26
Xa21 [O. sativa]	287	582	7e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	25	47	in -> out
putative TM domain	617	639	out -> in
putative TM domain	652	674	in -> out

Report for 4992.m00095

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)