Report for 5350.m00131

 > 5350.m00131, length: 891, copies: 2 

MELTGVLPDCIGNLTSLQSLLLARNNLEGTIPESLARSSSLIELNLSRNNLSGEIPPSFFNGSSKLVTVDLQTNS

FVGKIPLPRNMGTLRFLDLTGNLLSGRIPPSLANISSLSSILLGQNNLSGPIPESLSQIANLNKLDLSGNRLSGF

VPVTLYNKSSLEFFGIGNNSLIGKIPPDIGHTLPNLKSLVMSLNRFDGSIPTSLANASNLQMLDLSSNHLSGSVP

ALGSLRNLNKLLLGSNRLGADIWSLITSLTNCTRLLELSMDGNNLNGSLPKSIGNLSTHLQKLKFGGNQITGIIP

DEIGKLINLSLLEINTNKQSGQIPMTIGNLKKLFILNLSMNELSGQIPSTIGNLSQLGQLYLDNNNLSGKIPANI

GQCIRLAMLNLSVNNLDGSIPIELVNISSLSLGLDLSNNKLSGLIPQQVGTLHNLGHLNFSNNQLSGQIPSSLIQ

CAVLLSLNLENNNLSGSIPESLSQLPAIQQIDLSENNLSGVVPTGGIFGKPNSVNLKGNKGLCALTSIFALPICP

TSPAKRKKNNTRWLLIVILIPTVTVALFSILCIMFTLRKESTTQQSSNYKETMKRVSYGDILKATNWFSPVNKIS

SSHTGSVYIGRFEFDTDLVAIKVFHLDEQGAHNSFFRECEVLKCTRHRNLVKAITLCSTVDFDNNEFKALIYEFM

ANGNLEMFVHPKLYQGSPKRVLTLGQRISIAADIASALDYLHNQLVPPLIHCDLKPSNILLDYDMTSRIGDFGSA

KFLSSNFTKPEGFVGFGGTIGYIPPEYGMGCKISTAGDVYSFGVLLLEMFTAKRPTDTQFGSDLSLHKYVDSAFP

NTIGEVLDPHMPRDEKVVHDLWMQSFILPMIEIGLLCSKESPNDRPGMREVCAKIASIKQEFDKTM

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	16	39	1.3
LRR [Pfam ls]	40	64	0.0031
LRR [Pfam ls]	88	111	0.042
LRR [Pfam ls]	136	159	0.28
LRR [Pfam ls]	160	184	7.1
LRR [Pfam ls]	209	231	0.011
LRR [Pfam ls]	259	282	1.6
LRR [Pfam ls]	284	307	0.32
LRR [Pfam ls]	356	379	6.1
LRR [Pfam ls]	429	452	2.1
LRR [Pfam ls]	453	476	0.27
Ser/Thr pkinase [Pfam ls]	593	848	4.2e-36
Ser/Thr pkinase [Pfam fs]	605	807	1.4e-39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	16	39	0.065
LRR [sensitive, ls]	16	39	1.3
LRR [sensitive, ls]	40	64	0.00015
LRR [sensitive, ls]	40	64	0.0031
LRR [sensitive, ls]	65	87	1.8
LRR [sensitive, ls]	65	87	37
LRR [sensitive, ls]	88	111	0.0021
LRR [sensitive, ls]	88	111	0.042
LRR [sensitive, ls]	112	135	0.71
LRR [sensitive, ls]	112	135	14
LRR [sensitive, ls]	136	159	0.014
LRR [sensitive, ls]	136	159	0.28
LRR [sensitive, ls]	160	184	0.35
LRR [sensitive, ls]	160	184	7.1
LRR [sensitive, ls]	185	208	2
LRR [sensitive, ls]	185	208	40
LRR [sensitive, ls]	209	231	0.00055
LRR [sensitive, ls]	209	231	0.011
LRR [sensitive, ls]	232	255	2.7
LRR [sensitive, ls]	232	255	55
LRR [sensitive, ls]	259	282	0.08
LRR [sensitive, ls]	259	282	1.6
LRR [sensitive, ls]	284	307	0.016
LRR [sensitive, ls]	284	307	0.32
LRR [sensitive, ls]	332	355	0.55
LRR [sensitive, ls]	332	355	11
LRR [sensitive, ls]	356	379	0.3
LRR [sensitive, ls]	356	379	6.1
LRR [sensitive, ls]	380	403	1.5
LRR [sensitive, ls]	380	403	31
LRR [sensitive, ls]	405	428	5.3
LRR [sensitive, ls]	405	428	110
LRR [sensitive, ls]	429	452	0.11
LRR [sensitive, ls]	429	452	2.1
LRR [sensitive, ls]	453	476	0.013
LRR [sensitive, ls]	453	476	0.27
LRR [sensitive, ls]	477	501	0.97
LRR [sensitive, ls]	477	501	20

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	1	501	2e-51
Cf-9 [L. pimpinellifolium]	2	396	2e-30
FLS2 [A.thaliana]	2	884	1e-114
FLS2 [A.thaliana]	2	520	5e-64
Xa21 [O. sativa]	2	241	5e-28
Xa21 [O. sativa]	2	227	2e-23
Cf-9 [L. pimpinellifolium]	3	445	2e-44
CLV2 [A. thaliana]	3	264	6e-28
Xa21 [O. sativa]	3	704	1e-133
CLV2 [A. thaliana]	4	516	4e-54
FLS2 [A.thaliana]	4	510	8e-71
Cf-9 [L. pimpinellifolium]	7	512	2e-60
Cf-9 [L. pimpinellifolium]	13	484	2e-45
CLV2 [A. thaliana]	19	493	6e-46
Cf-9 [L. pimpinellifolium]	34	496	1e-48
CLV2 [A. thaliana]	38	470	8e-49
Xa21 [O. sativa]	92	493	2e-56
FLS2 [A.thaliana]	122	502	1e-50
Xa21 [O. sativa]	139	522	9e-47
Cf-9 [L. pimpinellifolium]	202	493	7e-31
Xa21 [O. sativa]	259	485	1e-36
Cf-9 [L. pimpinellifolium]	283	509	6e-14
Rpg1 [Hordeum vulgare]	584	883	5e-13
Pto [L. esculentum]	585	880	4e-22
Rpg1 [Hordeum vulgare]	590	883	8e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	538	560	out -> in

Report for 5350.m00131

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)