Report for 5479.m00106

 > 5479.m00106, length: 930, copies: 1 

MDPRLSYCCYLHGCLCVLVLLLCSWRAADAQAQQPPPHTDPTEAAALNAMMARLGLSAPPSWNISSDPCSGAATD

DTPLDDNPAFNPAIKCDCSDHNNTLCHITRLKINTLDVVGPIPEELRNLTHLIKLDFRKNYFTGPLPAFIGELTA

LKYITVGINALSGPIPKELGNLTNLVSLALGSNNFNGSLPDELGKLTKLQQLWALDNNFTGQIPDYLGSLTNLTQ

LRLQGNSFQGPIPRSLYNLVKLRSFVLRNSRISDSLASVDFSKFGSLNLLDLSFNNITGQIPPSIVNLPSLTFLN

LVANDFVIDGTDMSGLPWGLNCLQRNTPCFLGSPKSASFAVDCGGSRTISGSDNAMYQADNANLGAASYYVAGTP

TWGVSTTGRFMDPPNGSYIIYSSRQFDKTLDSGLFQTARMSPSSLRYYGIGLENGNYTVTLQFAEVDFPDVQSWR

SRGRRIFDIYIQVACKLTISLGERKEQNFDIRKAAGGKSFTVVKKQYVVPVTKNFLEIHLFWAGKGTCCIPHQGY

YGPAISALSATPIFALAALAGHFIWRQKKRKILLELEELYNIVGRPNVFSYNELRSATENFSSSNLLGEGGYGLV

HKGRLSDGRAVPVKQLSQSSNQGKKQFATEIETISRVQHCNLVTLYGCCLESNTPLLVYEYLENGSLDQALFGKG

SLNLDWPTRFEICLGLARGIAYLHEDSTVRIVHRDIKASNVLLDAGLNPKISDFGLAKLYDNKKTHVSTKVAGTF

GYLAPEYAMRGHMTEKVDVFAFGVVALETVAGESNYQNTLEEDRTYIFERVWELYENGHPLDFVDPKLSEFNSEE

VIRVIRVALLCTQGSPHKRPPMSKVVSMLTGDADITEDAAKPSYITEWQIKVGSCHHTGSSQVGSASTPPSSGDG

GAGQASSQGAGEGSPLTPSPLFTSIIDEGR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	174	197	2.1
LRR [Pfam ls]	222	245	0.11
LRR [Pfam ls]	271	294	0.011
Ser/Thr pkinase [Pfam fs]	586	813	1.5e-49
Ser/Thr pkinase [Pfam ls]	586	856	4.1e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	102	125	6.3
LRR [sensitive, ls]	102	125	130
LRR [sensitive, ls]	126	149	0.97
LRR [sensitive, ls]	126	149	20
LRR [sensitive, ls]	150	173	2
LRR [sensitive, ls]	150	173	41
LRR [sensitive, ls]	174	197	0.1
LRR [sensitive, ls]	174	197	2.1
LRR [sensitive, ls]	198	221	1.6
LRR [sensitive, ls]	198	221	32
LRR [sensitive, ls]	222	245	0.0055
LRR [sensitive, ls]	222	245	0.11
LRR [sensitive, ls]	246	270	0.72
LRR [sensitive, ls]	246	270	14
LRR [sensitive, ls]	271	294	0.00052
LRR [sensitive, ls]	271	294	0.011
LRR [sensitive, ls]	295	324	3.9
LRR [sensitive, ls]	295	324	78

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	97	306	1e-15
Cf-9 [L. pimpinellifolium]	98	305	6e-17
CLV2 [A. thaliana]	99	306	1e-10
FLS2 [A.thaliana]	99	304	4e-24
Cf-9 [L. pimpinellifolium]	100	291	7e-20
Cf-9 [L. pimpinellifolium]	100	304	3e-12
FLS2 [A.thaliana]	100	304	1e-28
FLS2 [A.thaliana]	100	306	2e-24
Xa21 [O. sativa]	100	287	1e-17
Xa21 [O. sativa]	100	306	4e-26
Xa21 [O. sativa]	100	301	1e-22
FLS2 [A.thaliana]	102	306	1e-24
FLS2 [A.thaliana]	103	305	2e-24
Xa21 [O. sativa]	103	306	9e-28
CLV2 [A. thaliana]	105	304	4e-14
CLV2 [A. thaliana]	106	316	3e-14
FLS2 [A.thaliana]	106	305	1e-22
FLS2 [A.thaliana]	112	356	4e-28
Cf-9 [L. pimpinellifolium]	113	307	1e-14
FLS2 [A.thaliana]	113	265	8e-15
CLV2 [A. thaliana]	115	306	8e-17
CLV2 [A. thaliana]	115	292	2e-16
CLV2 [A. thaliana]	115	304	1e-14
Xa21 [O. sativa]	121	315	9e-22
Xa21 [O. sativa]	122	304	8e-21
CLV2 [A. thaliana]	127	305	6e-15
CLV2 [A. thaliana]	147	324	2e-12
CLV2 [A. thaliana]	175	338	7e-16
FLS2 [A.thaliana]	574	854	3e-37
Pto [L. esculentum]	574	851	1e-53
Rpg1 [Hordeum vulgare]	574	855	4e-37
Rpg1 [Hordeum vulgare]	574	854	2e-34

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5479.m00106

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)