Report for 5498.m00193

 > 5498.m00193, length: 1104, copies: 1 

MPPPPRLLFLLVMLLVVAAPGAPVFGANAPPEVKAEIDALLMFRSGLRDPYAAMSGWNASSPSAPCSWRGVACAA

GTGRVVELALPKLRLSGAISPALSSLTFDVSGNLLSGPVPVSFPPSLKYLELSSNAFSGTIPANVSASATSLQFL

NLAVNRLRGTVPASLGTLQDLHYLWLDGNLLEGTIPSALSNCSALLHLSLQGNALRGILPPAVAAIPSLQILSVS

RNRLTGAIPAAAFGGVGNSSLRIVQVGGNAFSQVDVPVSLGKDLQVVDLRANKLAGPFPSWLAGAGGLTVLDLSG

NAFTGEVPPAVGQLTALQELRLGGNAFTGTVPAEIGRCGALQVLDLEDNRFSGEVPAALGGLRRLREVYLGGNSF

SGQIPASLGNLSWLEALSTPGNRLTGDLPSELFVLGNLTFLDLSDNKLAGEIPPSIGNLAALQSLNLSGNSFSGR

IPSNIGNLLNLRVLDLSGQKNLSGNLPAELFGLPQLQYVSLAGNSFSGDVPEGFSSLWSLRHLNLSVNSFTGSMP

ATYGYLPSLQVLSASHNRICGELPVELANCSNLTVLDLRSNQLTGPIPGDFARLGELEELDLSHNQLSRKIPPEI

SNCSSLVTLKLDDNHLGGEIPASLSNLSKLQTLDLSSNNLTGSIPASLAQIPGMLSLNVSQNELSGEIPAMLGSR

FGTPSVFASNPNLCGPPLENECSAYRQHRRRQRLQRLALLIGVVAATVLLLVLFCCCCVYSLLRWRRRFIEKRDG

VKKRRRSPGRGSGSSGTSTDSVSQPKLIMFNSRITYADTVEATRQFDEENVLSRGRHGLVFKACYNDGTVLAILR

LPSTSSDGAVVIEEGSFRKEAESLGKVKHRNLTVLRGYYAGPPPDVRLLVYDYMPNGNLATLLQEASHQDGHILN

WPMRHLIALGVSRGLAFLHQSGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAGAAAAAAAASTSATTTVGSL

GYVAPDAAAAGQATREGDVYSFGIVLLELLTGRRPGMFAGEDEDIVKWVKRQLQRGAVAELLEPGLLELDPESSE

WEEFLLGIKVGLLCTAPDPLDRPAMGDVVFMLEGCRVGPDIPSSADPTSQPSPA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	121	145	0.27
LRR [Pfam ls]	146	169	4
LRR [Pfam ls]	170	193	0.19
LRR [Pfam ls]	218	242	0.17
LRR [Pfam ls]	292	315	0.012
LRR [Pfam ls]	316	339	7.1
LRR [Pfam ls]	340	363	0.071
LRR [Pfam ls]	364	387	0.16
LRR [Pfam ls]	412	435	0.003
LRR [Pfam ls]	436	459	0.066
LRR [Pfam ls]	460	484	0.1
LRR [Pfam ls]	485	508	1.1
LRR [Pfam ls]	509	532	4.5
LRR [Pfam ls]	533	556	0.5
LRR [Pfam ls]	557	580	0.0048
LRR [Pfam ls]	581	604	0.002
LRR [Pfam ls]	605	628	0.14
LRR [Pfam ls]	629	652	0.0043
Ser/Thr pkinase [Pfam fs]	796	1010	1.1e-28
Ser/Thr pkinase [Pfam ls]	796	1080	1.7e-26

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	121	145	0.013
LRR [sensitive, ls]	121	145	0.27
LRR [sensitive, ls]	146	169	0.2
LRR [sensitive, ls]	146	169	4
LRR [sensitive, ls]	170	193	0.0096
LRR [sensitive, ls]	170	193	0.19
LRR [sensitive, ls]	194	217	0.62
LRR [sensitive, ls]	194	217	12
LRR [sensitive, ls]	218	242	0.0085
LRR [sensitive, ls]	218	242	0.17
LRR [sensitive, ls]	268	291	2.4
LRR [sensitive, ls]	268	291	48
LRR [sensitive, ls]	292	315	0.00061
LRR [sensitive, ls]	292	315	0.012
LRR [sensitive, ls]	316	339	0.35
LRR [sensitive, ls]	316	339	7.1
LRR [sensitive, ls]	340	363	0.0035
LRR [sensitive, ls]	340	363	0.071
LRR [sensitive, ls]	364	387	0.0082
LRR [sensitive, ls]	364	387	0.16
LRR [sensitive, ls]	412	435	0.00015
LRR [sensitive, ls]	412	435	0.003
LRR [sensitive, ls]	436	459	0.0033
LRR [sensitive, ls]	436	459	0.066
LRR [sensitive, ls]	460	484	0.0052
LRR [sensitive, ls]	460	484	0.1
LRR [sensitive, ls]	485	508	0.052
LRR [sensitive, ls]	485	508	1.1
LRR [sensitive, ls]	509	532	0.22
LRR [sensitive, ls]	509	532	4.5
LRR [sensitive, ls]	533	556	0.025
LRR [sensitive, ls]	533	556	0.5
LRR [sensitive, ls]	557	580	0.00024
LRR [sensitive, ls]	557	580	0.0048
LRR [sensitive, ls]	581	604	0.0001
LRR [sensitive, ls]	581	604	0.002
LRR [sensitive, ls]	605	628	0.0069
LRR [sensitive, ls]	605	628	0.14
LRR [sensitive, ls]	629	652	0.00021
LRR [sensitive, ls]	629	652	0.0043
LRR [sensitive, ls]	653	677	2.2
LRR [sensitive, ls]	653	677	45

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	5	906	6e-91
CLV2 [A. thaliana]	9	729	7e-69
FLS2 [A.thaliana]	27	1079	1e-133
Cf-9 [L. pimpinellifolium]	51	702	1e-53
N [N. glutinosa]	402	653	6e-11
Pto [L. esculentum]	768	1083	1e-35
Rpg1 [Hordeum vulgare]	793	1079	2e-23
Rpg1 [Hordeum vulgare]	793	1008	4e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	716	738	out -> in

Report for 5498.m00193

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)