Report for 5515.m00190

 > 5515.m00190, length: 827, copies: 1 

MRRLVASQELLLVLLISLQCLSCLAIANPALDRQAEALLQWKSGLRGDLSYCGLEEWSNATSPCNWSGIYCSYKV

RRGHERDAILVVTNITLFSCNISGGLSKLRFAQLPHLVFLDLSINSLYGPIPSDIGRLAELSYLDLSNNKLTGSI

PPSIGNLTNLGFLELSNNYLSQGILSCLPDTLHNLQYLDLSHNSLTGPIPSSLGNLARLYFLDLGFNNLFGHIPR

EIGMLHSLVALDLDHNNINGSIPTTIGNLTSLKSLDLSTNEITGFIPESIGNLSLIELYLSINEITGFIPESIGN

LRSLIKLYLSTNEITGSIPESIGNLTSLQNMDLSNNRIIGPIPSTFSKLISLITLKLESNVLNAILPPELGFLRN

LFVLDLSSNQFTGSIPPQIGQFHHLSLLRLRNNLLTGPIPEELGYCTDLTELDLSRNNLSGAIPMTFMMLYRLLE

LNLSYNSLGGRFFGFYTTEASSVVSLDHNTGICGDPLYGLTPCQPSNPNPDSLHTNENSDSKHLVPRLLLAFAMF

SCIWLVGGSITVVCWRRKLAKKGKEIIPGDFVSIWNFDAKVAFQDALYATENFDEKYCIGVGSYGSVLELRSKEK

CKFLVYDLIERGSLASIWNDQELAKELDWCKRVTIVMDIAQALSYLHHDCDDPIVHRDIKSSNILLDHDFKAYLS

DFGMAKKLKDNSSSWSTIFAGTCGYIAPELSSTMVLTEKCDVYSFGVVMLEVVMGKHPGDLLLPFFCRTEQHTKL

KDILDQRIMAPTTEEKDIILLVLVAFACLQICPKSRPTMQQVCQAMTTRSLPAPILKPLDEIKLQHFHDFCGTIQ

NI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	111	134	8.3
LRR [Pfam fs]	135	158	1.9e-05
LRR [Pfam ls]	135	158	0.00031
LRR [Pfam fs]	184	207	7.3e-06
LRR [Pfam ls]	184	207	0.00011
LRR [Pfam ls]	232	255	0.09
LRR [Pfam ls]	256	276	7.2
LRR [Pfam ls]	279	302	0.03
LRR [Pfam ls]	303	326	0.062
LRR [Pfam ls]	327	350	0.17
LRR [Pfam ls]	375	398	0.062
LRR [Pfam ls]	399	422	1.7
LRR [Pfam ls]	423	446	6
Ser/Thr pkinase [Pfam ls]	525	796	8.9e-14
Ser/Thr pkinase [Pfam fs]	612	733	1.2e-26

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	86	110	6
LRR [sensitive, ls]	86	110	120
LRR [sensitive, ls]	111	134	0.4
LRR [sensitive, ls]	111	134	8.3
LRR [sensitive, ls]	135	158	1.5e-05
LRR [sensitive, ls]	135	158	0.00031
LRR [sensitive, ls]	159	183	0.76
LRR [sensitive, ls]	159	183	16
LRR [sensitive, ls]	184	207	5.2e-06
LRR [sensitive, ls]	184	207	0.00011
LRR [sensitive, ls]	208	231	0.62
LRR [sensitive, ls]	208	231	13
LRR [sensitive, ls]	232	255	0.0043
LRR [sensitive, ls]	232	255	0.09
LRR [sensitive, ls]	256	276	0.35
LRR [sensitive, ls]	256	276	7.2
LRR [sensitive, ls]	279	302	0.0014
LRR [sensitive, ls]	279	302	0.03
LRR [sensitive, ls]	303	326	0.003
LRR [sensitive, ls]	303	326	0.062
LRR [sensitive, ls]	327	350	0.008
LRR [sensitive, ls]	327	350	0.17
LRR [sensitive, ls]	351	374	1.8
LRR [sensitive, ls]	351	374	37
LRR [sensitive, ls]	375	398	0.003
LRR [sensitive, ls]	375	398	0.062
LRR [sensitive, ls]	399	422	0.081
LRR [sensitive, ls]	399	422	1.7
LRR [sensitive, ls]	423	446	0.29
LRR [sensitive, ls]	423	446	6
LRR [sensitive, ls]	447	480	3.1
LRR [sensitive, ls]	447	480	64

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	9	460	5e-38
FLS2 [A.thaliana]	24	463	5e-69
CLV2 [A. thaliana]	29	460	5e-45
Xa21 [O. sativa]	37	492	8e-61
CLV2 [A. thaliana]	70	479	1e-44
Cf-9 [L. pimpinellifolium]	78	391	7e-28
FLS2 [A.thaliana]	78	384	3e-37
CLV2 [A. thaliana]	80	276	3e-12
Xa21 [O. sativa]	82	592	9e-54
FLS2 [A.thaliana]	89	345	2e-36
FLS2 [A.thaliana]	90	491	1e-55
Cf-9 [L. pimpinellifolium]	92	416	1e-35
FLS2 [A.thaliana]	102	457	6e-50
Cf-9 [L. pimpinellifolium]	103	461	4e-36
FLS2 [A.thaliana]	109	479	2e-52
FLS2 [A.thaliana]	111	432	7e-45
CLV2 [A. thaliana]	112	419	9e-34
FLS2 [A.thaliana]	112	736	6e-74
FLS2 [A.thaliana]	112	460	1e-54
CLV2 [A. thaliana]	115	456	1e-41
Cf-9 [L. pimpinellifolium]	233	479	2e-17
CLV2 [A. thaliana]	233	480	9e-27
Pto [L. esculentum]	569	792	3e-20
Rpg1 [Hordeum vulgare]	602	797	2e-15
Rpg1 [Hordeum vulgare]	602	796	2e-11

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	518	540	out -> in

Report for 5515.m00190

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)