Report for 5584.m00120

 > 5584.m00120, length: 775, copies: 1 

MKPPLLTALEPYYGFSHFTGVSMPAKRVVQGKQWIIEMHHDGERHALLRRIQPLIGPEFSSSGRLDWDEAVDCCR

WEGVTCSVAGRRREAAAGGRRVVSLSLPGVGIAGAVDAAVLAPFTALEKLDLSGNQITSFSAANRSDMVVGAVLN

NLTALTELHLAGNEITTTGWISNLTSLQVIDMSSNKVHELNGICGLHQLKYLSLGFNMIQGVINPCLGKLQYLVY

LDMGSNFLTGEIGQYLLSNLTQVEEVHLGDNNLTGTFDFSSLANNSELHSIVLSNNCKLEIETELVRWTPLFQLE

YLNLSNSIVNKRSNGIIPTFLSAQVSLSGIDLSICSLQGRIPSWMLLYNVSLGFLLLRGNSMDFLDTGNLGANVT

SSMEVLDLSDNRISMKMPYNFGSLFPYLKYLDMSSNMLNGGVPSLAEAASSLQFLDLSFNMLNGEISPELIGNAS

ILTSLLLSHNDLTGPMPPFHWSLGQLTHLSVENNQLSGRLPPLLTNCTNLENLNVRNNRLSGVIPVGLLSFEKLG

ALLLGGNQFHGCLYSVFWSELPMNSEDDPFGNITQRRQTYVEFTTKGESLTYMGMPLELMIGIDLSMNRLSGPIP

SSVGFLLQLKSLNLSHNKLVGSIPDTFMYLHEMESMDLSHNHLNGSVPVELANLSFLSFFSVAYNNLSGEIPFES

QFCTLNGTAFEGNENLCGEIVDKICPMNSNCSHDSDDEMHQLLSTDTMDTPLIYWSFVAGSFAIGFWGIIALLIW

NTAFRSRLCSFMDGCMSKMGWFLVP

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	121	153	2.1
LRR [Pfam ls]	154	175	1.3
LRR [Pfam ls]	176	197	2.9
LRR [Pfam ls]	198	221	2
LRR [Pfam ls]	222	246	0.89
LRR [Pfam ls]	247	271	4.5
LRR [Pfam ls]	377	400	1.9
LRR [Pfam ls]	426	450	0.032
LRR [Pfam ls]	475	498	0.069
LRR [Pfam ls]	499	520	0.58
LRR [Pfam ls]	608	631	0.016
LRR [Pfam ls]	632	655	1.8

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	121	153	0.1
LRR [sensitive, ls]	121	153	2.1
LRR [sensitive, ls]	154	175	0.064
LRR [sensitive, ls]	154	175	1.3
LRR [sensitive, ls]	176	197	0.14
LRR [sensitive, ls]	176	197	2.9
LRR [sensitive, ls]	198	221	0.099
LRR [sensitive, ls]	198	221	2
LRR [sensitive, ls]	222	246	0.044
LRR [sensitive, ls]	222	246	0.89
LRR [sensitive, ls]	247	271	0.22
LRR [sensitive, ls]	247	271	4.5
LRR [sensitive, ls]	298	324	1.3
LRR [sensitive, ls]	298	324	26
LRR [sensitive, ls]	326	348	3.8
LRR [sensitive, ls]	326	348	76
LRR [sensitive, ls]	377	400	0.093
LRR [sensitive, ls]	377	400	1.9
LRR [sensitive, ls]	402	424	0.91
LRR [sensitive, ls]	402	424	18
LRR [sensitive, ls]	426	450	0.0016
LRR [sensitive, ls]	426	450	0.032
LRR [sensitive, ls]	451	472	1.5
LRR [sensitive, ls]	451	472	29
LRR [sensitive, ls]	475	498	0.0034
LRR [sensitive, ls]	475	498	0.069
LRR [sensitive, ls]	499	520	0.029
LRR [sensitive, ls]	499	520	0.58
LRR [sensitive, ls]	608	631	0.00077
LRR [sensitive, ls]	608	631	0.016
LRR [sensitive, ls]	632	655	0.087
LRR [sensitive, ls]	632	655	1.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	65	754	4e-49
CLV2 [A. thaliana]	73	747	5e-41
FLS2 [A.thaliana]	74	674	4e-46
Xa21 [O. sativa]	90	536	8e-21
FLS2 [A.thaliana]	104	710	2e-46
Xa21 [O. sativa]	193	718	1e-33
FLS2 [A.thaliana]	202	671	9e-35
FLS2 [A.thaliana]	372	707	5e-28
FLS2 [A.thaliana]	437	699	8e-17
FLS2 [A.thaliana]	472	679	3e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	728	750	out -> in

Report for 5584.m00120

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)