Report for 5700.m00166

 > 5700.m00166, length: 934, copies: 1 

MAPLHRRLLHLAVVFAGLLLPGVRAGTGGAASGDAGALLAARAALTDPTAALSAWRGDNLCRWPHVACDAAAGNA

AVSXGVXXGLYLVRSVPRRGALETLNLASNNFSGELPAAYGGGFPSLAVLNLIQNLVSGAFPGFLANVTALQELL

LAYNSFSPSPLPDNLGDLAALRVLFLANCSLTGSIPPSVGKLTNLVDLDLSSNNLTGEIPPSIVNLSSLVQIELF

SNQLSGRIPAGLGGLKKLQQLDISMNHISGEIPEDMFAAPSLESVHMYQNNLTGRLPATLAAAARLTELMIFANQ

IEGPFPPEFGKNCPLQSLDVSDNRMSGRIPATLCAGGKLSQLLLLNNMFDGAIPDELGKCRSLMRVRLPCNRLSG

PVPPEFWGLPHVYLLELRGNAFSGNVGAAIGRAANLSNLIIDNNRFTGVLPAELGNLTQLVVLSASDNSFTGTVP

PSLASLSVLFLLDLSNNSLSGEIPRSIGELKNLTLLNLSDNHLSGSIPEELGGMDKMSTLDLSNNELSGQVPAQL

QDLKLLGVLNLSYNKLTGHLPILFDTDQFRPCFLGNPGLCYGLCSRNGDPDSNRRARIQMAVAILTAAAGILLTS

VAWFIYKYRSYNKRAIEVDSENSEWVLTSFHKVEFNERDIVNSLTENNLIGKGSSGMVYKAVVRPRSDTLAVKKL

WASSTVASKKIDSFEAEVETLSKVRHKNIVKLFCCLTNEACRLLVYEFMPNGSLGDFLHSAKAGILDWPARYNIA

LDAAEGLSYLHHDFVPAIIHRDVKSNNILLDADFRAKIADFGVAKSIGDGPATMSVIAGSCGYIAPEYAYTIRVT

EKSDVYSFGVVMLELVTGKSPMSSDIGDKDLVAWAATNVEQNGAESVLDEKIAEHFKDEMCRVLRIALLCVKNLP

NNRPSMRLVVKFLLDIKGENKPKAMKITEALPAT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	96	120	1
LRR [Pfam ls]	170	193	0.045
LRR [Pfam ls]	194	217	0.0028
LRR [Pfam ls]	218	241	0.57
LRR [Pfam ls]	242	265	4
LRR [Pfam ls]	410	433	0.29
LRR [Pfam ls]	434	457	0.24
LRR [Pfam ls]	458	481	0.5
LRR [Pfam ls]	482	505	0.0019
LRR [Pfam ls]	506	529	0.12
Ser/Thr pkinase [Pfam fs]	644	855	1.1e-46
Ser/Thr pkinase [Pfam ls]	644	915	5.5e-43

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	96	120	0.039
LRR [sensitive, ls]	96	120	1
LRR [sensitive, ls]	121	144	1.4
LRR [sensitive, ls]	121	144	37
LRR [sensitive, ls]	145	169	0.58
LRR [sensitive, ls]	145	169	15
LRR [sensitive, ls]	170	193	0.0018
LRR [sensitive, ls]	170	193	0.045
LRR [sensitive, ls]	194	217	0.00011
LRR [sensitive, ls]	194	217	0.0028
LRR [sensitive, ls]	218	241	0.022
LRR [sensitive, ls]	218	241	0.57
LRR [sensitive, ls]	242	265	0.16
LRR [sensitive, ls]	242	265	4
LRR [sensitive, ls]	266	289	0.3
LRR [sensitive, ls]	266	289	7.7
LRR [sensitive, ls]	290	313	1.2
LRR [sensitive, ls]	290	313	32
LRR [sensitive, ls]	314	338	0.41
LRR [sensitive, ls]	314	338	11
LRR [sensitive, ls]	362	385	0.72
LRR [sensitive, ls]	362	385	18
LRR [sensitive, ls]	410	433	0.011
LRR [sensitive, ls]	410	433	0.29
LRR [sensitive, ls]	434	457	0.0095
LRR [sensitive, ls]	434	457	0.24
LRR [sensitive, ls]	458	481	0.02
LRR [sensitive, ls]	458	481	0.5
LRR [sensitive, ls]	482	505	7.4e-05
LRR [sensitive, ls]	482	505	0.0019
LRR [sensitive, ls]	506	529	0.0047
LRR [sensitive, ls]	506	529	0.12
LRR [sensitive, ls]	530	553	0.35
LRR [sensitive, ls]	530	553	9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	8	734	3e-83
CLV2 [A. thaliana]	34	522	3e-55
FLS2 [A.thaliana]	47	549	8e-78
FLS2 [A.thaliana]	93	546	4e-63
FLS2 [A.thaliana]	96	919	1e-105
Cf-9 [L. pimpinellifolium]	97	525	3e-38
Cf-9 [L. pimpinellifolium]	97	259	1e-13
CLV2 [A. thaliana]	97	575	3e-50
Cf-9 [L. pimpinellifolium]	100	564	2e-49
Cf-9 [L. pimpinellifolium]	164	546	1e-32
FLS2 [A.thaliana]	392	551	2e-17
Pto [L. esculentum]	629	906	1e-35
Rpg1 [Hordeum vulgare]	634	916	1e-31
Rpg1 [Hordeum vulgare]	641	911	3e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	583	605	out -> in

Report for 5700.m00166

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)