Report for 5820.m00122

 > 5820.m00122, length: 375, copies: 2 

MERLRSGATQPYSSNSAESENISSVESMLIDISTLRAATGCFAERNKLGEGGFGAVYKGTLPDGDEIAVKRLSKS

SAQGVGELKNELALVAKLQHKNLVRLVGVCLEQEERLLVYEFVPNRSLDQILFDADKRQQLDWGKRYKIINGIAR

GLQYLHEDSQLKVVHRDLKASNILLDMNMNPKISDFGLARLFGRDQTQGVTNLVIGTYGYMSPEYAMRGNYSLKS

DVFSFGVMVLEIVTGKKNNDCYNSLQSEDLLTLVSTNHMILLVCSWKNEVWEQWTARAVSEAVDPVMGGGFSWSD

VMRCIHIGLLCVQENPADRPVMSSVVMMLGSDTVSLRAPSKPAFCARRNGGTGGAGASSGGTSSGTSTAASVQGK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
Ser/Thr pkinase [Pfam fs]	42	240	1.7e-57
Ser/Thr pkinase [Pfam ls]	42	327	9.4e-53

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Pto [L. esculentum]	7	329	2e-43
FLS2 [A.thaliana]	13	329	7e-27
Rpg1 [Hordeum vulgare]	32	329	3e-31
Rpg1 [Hordeum vulgare]	35	339	2e-46

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5820.m00122

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)