Report for 5871.m00143

 > 5871.m00143, length: 391, copies: 1 

MISRGHAAAAWALLLLLLGAAVAQHEGNVSEEYAASFASRYDAPPSWAFPNPRLRAAYAALQAWKQTAIFSDPSN

FTASWVGANVCAYNGVYCAPSPGYGGGGGGGLVVAGIDLNHADIAGYLPASLPLGLPDLALIHLNSNRFCGVVPD

TFRRLRLLHELDLSNNRFVGAFPEVVLALPSLRYLDLRFNDFEGSIPPALFDRPLDAIFLNSNRLRNPIPANLGN

SPASVVVLAHNNLGGCIPPSIGKMADTLNEIVLIADELTGCVPTQVGLLRKVTVFDVSDNHLQGPIPASVAGMAA

VEQLDVARNLFEGAVPAGVCGLASLKNFTYTDNFITSRPGCGVATADGVWNCIPRRAGAAAAVAVRRRCGAPVRL

QQGAMPGRVLHPDARW

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	133	156	6.2
LRR [Pfam ls]	157	180	5
LRR [Pfam ls]	181	205	0.063
LRR [Pfam ls]	276	299	8

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	133	156	0.3
LRR [sensitive, ls]	133	156	6.2
LRR [sensitive, ls]	157	180	0.24
LRR [sensitive, ls]	157	180	5
LRR [sensitive, ls]	181	205	0.003
LRR [sensitive, ls]	181	205	0.063
LRR [sensitive, ls]	276	299	0.38
LRR [sensitive, ls]	276	299	8
LRR [sensitive, ls]	300	323	4.4
LRR [sensitive, ls]	300	323	90

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	60	337	2e-21
Xa21 [O. sativa]	64	324	2e-19
CLV2 [A. thaliana]	72	336	1e-14
FLS2 [A.thaliana]	107	349	4e-16
Cf-9 [L. pimpinellifolium]	112	333	2e-15
CLV2 [A. thaliana]	112	333	4e-17
FLS2 [A.thaliana]	112	316	1e-16
FLS2 [A.thaliana]	112	352	3e-14
Xa21 [O. sativa]	112	312	1e-13
FLS2 [A.thaliana]	113	294	7e-11
CLV2 [A. thaliana]	114	316	3e-12
FLS2 [A.thaliana]	123	333	3e-15
FLS2 [A.thaliana]	127	336	1e-19
FLS2 [A.thaliana]	131	333	4e-15
CLV2 [A. thaliana]	134	336	8e-17
Xa21 [O. sativa]	137	329	6e-19
FLS2 [A.thaliana]	146	338	2e-19

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 5871.m00143

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)