Report for 5948.m00204

 > 5948.m00204, length: 776, copies: 2 

MAISLLLLLLLLGAGHMTQPTAAALNQDGVLLLSFKFSLLADPLASLAGWGYSDDTPCAWNGVVCMAFPSSSASE

AARVVSVVLPNAQLVGPIARELGLIEHLRHLDLSGNALNGTVPVELLRAPELRVLSLAGNGINGALPDQVGQLRS

LRALNLAGNALSGPIPANLTLLPNLTAVSLANNFFSGALPVGGFPALQVLDVSSNLLNGTLPPDFGGAALRYVNL

SSNRLAGAIPPEMASRLPPNVTIDLSYNNLTGAIPTLAPFTVQRPTAFAGNAELCGRPLDSLCASAADPPINGTA

RSPPAIAAIPKNPTEALPGDDTGAPASGSGQQGRMRMATIIAIAAGDVAGIAVLVVVFMYVYQVRKKRQREEAAK

QRMGVVFKKPEPDESPDGIGRSLSCCLRKKAGDESDSTEEVTDTSASKEGVVAAKAKTDDKKGKDGGGGAVLVTV

DGEVELEMETLLKASAYILGAAGSSIVYKAVLADGAVLAVRRIGSDDAGVRRFSEFDAHMRAIARLRHANILRLR

GFYWGPDEMLLIHDFAANGSLANISVKRKTGSSPISLSWSSRLRIARGVARGLAFLHDKKFVHGNVRPSNILLDA

DMEPLLADLGIHRLIRGGDTLKPAAAAGAGRFGSKRSAKSLPDLSPPPGASPLAGPSGSGDTAVAQYQAPEGVKN

PKANAKWDVYSLGMVLLELVAGRALTSLELCQWSSAEESGQQVFRLADAALRGEMAGREEALASCLRLGFACCAM

APHKRPSMKEVVAAMDRIPSPSSSAQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	102	125	0.12
LRR [Pfam ls]	126	149	2
LRR [Pfam ls]	150	173	0.37
LRR [Pfam ls]	196	216	4.7
LRR [Pfam ls]	219	243	0.44
Ser/Thr pkinase [Pfam ls]	467	762	5.9e-17
Ser/Thr pkinase [Pfam fs]	514	611	1.3e-18
Ser/Thr pkinase [Pfam fs]	669	763	0.002

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	102	125	0.0047
LRR [sensitive, ls]	102	125	0.12
LRR [sensitive, ls]	126	149	0.079
LRR [sensitive, ls]	126	149	2
LRR [sensitive, ls]	150	173	0.014
LRR [sensitive, ls]	150	173	0.37
LRR [sensitive, ls]	174	195	0.57
LRR [sensitive, ls]	174	195	15
LRR [sensitive, ls]	196	216	0.18
LRR [sensitive, ls]	196	216	4.7
LRR [sensitive, ls]	219	243	0.017
LRR [sensitive, ls]	219	243	0.44

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	27	269	5e-12
Xa21 [O. sativa]	28	260	2e-30
FLS2 [A.thaliana]	32	260	7e-21
Xa21 [O. sativa]	58	378	4e-21
CLV2 [A. thaliana]	71	260	3e-15
FLS2 [A.thaliana]	71	260	2e-20
FLS2 [A.thaliana]	71	260	2e-17
Cf-9 [L. pimpinellifolium]	72	288	4e-16
CLV2 [A. thaliana]	74	237	2e-14
FLS2 [A.thaliana]	78	276	7e-18
Cf-9 [L. pimpinellifolium]	79	260	5e-14
FLS2 [A.thaliana]	79	262	7e-18
FLS2 [A.thaliana]	81	260	5e-17
Xa21 [O. sativa]	84	260	6e-11
FLS2 [A.thaliana]	86	212	2e-12
CLV2 [A. thaliana]	89	263	2e-20
FLS2 [A.thaliana]	89	774	3e-36
FLS2 [A.thaliana]	89	260	6e-22
FLS2 [A.thaliana]	89	260	7e-16
FLS2 [A.thaliana]	89	260	1e-14
CLV2 [A. thaliana]	90	261	2e-16
Cf-9 [L. pimpinellifolium]	101	212	3e-11
Cf-9 [L. pimpinellifolium]	102	271	1e-10
CLV2 [A. thaliana]	106	260	2e-14
Pto [L. esculentum]	455	762	1e-23
Rpg1 [Hordeum vulgare]	456	768	3e-14
Rpg1 [Hordeum vulgare]	464	768	5e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	340	362	out -> in

Report for 5948.m00204

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)