Report for 6103.m00140

 > 6103.m00140, length: 751, copies: 1 

MSSWSSNETMFGFCHWKGVTCSSHAHPGRVTALRMRDLGLVGAISPQLSNLTYLQALDLSNNRLQGEIPHDLGSC

VALRAINLSVNSLSGQIPWSIGNLPKLAVLNVRNNKISGNVPASLGNLTALTMLSIADNYVNGRIPPWIGNMTNL

TDLNVAGNVFHGYVPSNIAGLTNLLALSLLGNKLQGVFPPELFNITSLEIMYIGLNMLSGFLPMDIGPKLPNLVF

LSTIYNQFEGPIPDSLSNISKLEYLQLHGNKFQGRIPPNIWSSGTITRLNLGNNILEAKTPNDRDFLTSLTNCSE

LVTLDLQFNRLSGFIPNTLVNLSQELIWIGLGGNQIFGTIPAGIGRFRKLTVLELAECPSSLAHNSHSKHQVQLI

LIICVVGGFTIFACLVTFYFIKDQRTIPKDIDHEEHITSLLIKKYPRISYVELYAATDSLSSENLIGRGSFGYVY

KGNLTSGVNSATVAMKVLDLRQKGQTQGFFAECDALRRIQHRKLVKVVTVCDSLDYNGNEFKAIVLEFISNRSLD

TWLKTGNKVGTLSLIQRLNIILDVAQALEYLHNHIEPPIVHCDIKPSNILLDEDMVAHVSDFGLAKIMSVDASRQ

SLGESISNGVRGSIGYLAPEYGMGAEISARGGVYSYGVLVLQMLTGKEPTDAIYDGTTSLPKYVEMTYPDKLSPI

VDAAIIANSGGGQETINMFIVPVAKIGLACCRDNASQRMNFGEIVKELVPLNKLCQDYFLTQGASSGNTSDIGIT

L

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	53	76	0.03
LRR [Pfam ls]	77	100	3.3
LRR [Pfam ls]	101	124	0.14
LRR [Pfam ls]	149	172	3.7
LRR [Pfam ls]	246	269	0.29
LRR [Pfam ls]	300	323	0.038
Ser/Thr pkinase [Pfam fs]	435	676	7e-41
Ser/Thr pkinase [Pfam ls]	435	725	5.9e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	29	52	2.4
LRR [sensitive, ls]	29	52	55
LRR [sensitive, ls]	53	76	0.0013
LRR [sensitive, ls]	53	76	0.03
LRR [sensitive, ls]	77	100	0.14
LRR [sensitive, ls]	77	100	3.3
LRR [sensitive, ls]	101	124	0.0059
LRR [sensitive, ls]	101	124	0.14
LRR [sensitive, ls]	125	148	0.29
LRR [sensitive, ls]	125	148	6.8
LRR [sensitive, ls]	149	172	0.16
LRR [sensitive, ls]	149	172	3.7
LRR [sensitive, ls]	173	196	0.85
LRR [sensitive, ls]	173	196	20
LRR [sensitive, ls]	197	221	3.7
LRR [sensitive, ls]	197	221	87
LRR [sensitive, ls]	246	269	0.012
LRR [sensitive, ls]	246	269	0.29
LRR [sensitive, ls]	270	296	0.96
LRR [sensitive, ls]	270	296	22
LRR [sensitive, ls]	300	323	0.0016
LRR [sensitive, ls]	300	323	0.038
LRR [sensitive, ls]	325	348	0.98
LRR [sensitive, ls]	325	348	23

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	3	356	3e-21
FLS2 [A.thaliana]	14	350	2e-48
Xa21 [O. sativa]	14	356	1e-59
CLV2 [A. thaliana]	15	356	2e-28
FLS2 [A.thaliana]	15	726	2e-77
Xa21 [O. sativa]	15	344	3e-39
Cf-9 [L. pimpinellifolium]	17	343	2e-27
Cf-9 [L. pimpinellifolium]	23	344	6e-27
CLV2 [A. thaliana]	29	368	9e-26
FLS2 [A.thaliana]	29	357	2e-42
Cf-9 [L. pimpinellifolium]	30	355	3e-26
FLS2 [A.thaliana]	30	355	2e-38
CLV2 [A. thaliana]	32	347	5e-27
CLV2 [A. thaliana]	41	354	5e-28
Xa21 [O. sativa]	42	528	3e-63
Cf-9 [L. pimpinellifolium]	54	211	2e-11
CLV2 [A. thaliana]	149	367	9e-11
FLS2 [A.thaliana]	150	356	3e-15
Pto [L. esculentum]	422	647	8e-25
Rpg1 [Hordeum vulgare]	428	723	3e-21
Rpg1 [Hordeum vulgare]	432	723	1e-26

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	374	396	in -> out

Report for 6103.m00140

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)