Report for 6324.m00130

 > 6324.m00130, length: 1058, copies: 1 

MGLVLTLLVLLVIMSSSTSTTVAEHHRIRSNDTDLAALLAFKARVSDPLGFLRDGWREDNASCFCQWIGVSCSRR

RQRVTALQLPGVPLQGTLTPHLGNLSFLIVLNLANTSLTGTLPGDIGKLHRLELLDLGYNALSGNIPATIGNLTK

LELLDLQFNRLSGPIPAELQGLRSLGSMNLRRNYLSGSIPVSVFNNTPLLAYLNIGNNSLSGLIPTAIGSLSMLQ

VLVLQYNQLSGSLPPTIFNMSRLEKLQASDNNLSGPIPFPTGNQSTIQLISLAFNSFTGRIPPRLAACRELQLLA

ISGNLLTDHVPEWLAGLSQLSSISLAANDLVGTVPAVLSNLTKLTVLDLSYSKLSGMIPLELGKLIQLNILHLSA

NQLTGPFPTSLGNLTKLSLLALDRNLLTGPLPVTLGNLRSLYHLHIAENHLQGELDFLAYLSNCRKLQFLDISMN

SFSGSIPSSLLANLSINLLKFFAEDNNLTGRQIGTLKGMVTLSLGGNKISSSIPNGVGNLSTLQYLSLSYNWLSS

YIPASLVNLSNLLQLDISHNNLTGALPSDLSPLKAIAGMDISANNLVGSLPTSWGQLQLLSYLNLSQNTFNDLIP

DSFKGLVNLETLDLSHNNLSGGIPKYFANLTFLTSLNLSFNNLQGQIPSGGVFSNITLQSLMGNARLCGAQHLGF

PACLEKSHSTRRKHLLKIVLPAVIAAFGAIVVLLYLMIGKKMKNPDITASFDTADAICHRLVSYQEIVRATENFN

EDNLLGVGSFGKVFKGRLDDGLVVAIKILNMQVERAIRSFDAECHVLRMARHRNLIKILNTCSNLDFRALFLQFM

PNGNLESYLHSESRPCVGSFLKRMEIMLDVSMAMEYLHHEHHEVVLHCDLKPSNVLFDEEMTAHVADFGIAKMLL

EDDNSAVSASMPGTIGYMAPEYALMGKASRKSDVFSFGIMLLEVFTGKRPTDPMFIGGLTLRLWVSQSFPKNLID

VADEHLLQDEETRLCFDYQNTSLGSSSTSRSNSFLTSIFELGLLCSSESPEQRMAMNDVVSKLKGIKKDYSASML

EMQRRRQY

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	102	125	1.4
LRR [Pfam ls]	126	149	0.036
LRR [Pfam ls]	150	173	0.033
LRR [Pfam ls]	174	198	3.4
LRR [Pfam ls]	199	222	0.18
LRR [Pfam ls]	223	246	1
LRR [Pfam ls]	295	318	0.6
LRR [Pfam ls]	343	366	0.38
LRR [Pfam ls]	367	390	0.24
LRR [Pfam ls]	441	465	0.075
LRR [Pfam ls]	488	511	1.2
LRR [Pfam ls]	512	535	0.077
LRR [Pfam ls]	536	559	0.0055
LRR [Pfam ls]	584	607	0.056
LRR [Pfam fs]	608	631	1.9e-06
LRR [Pfam ls]	608	631	2.7e-05
LRR [Pfam ls]	632	654	0.17
Ser/Thr pkinase [Pfam fs]	749	952	8.6e-48
Ser/Thr pkinase [Pfam ls]	749	999	3.1e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	78	101	6.7
LRR [sensitive, ls]	78	101	73
LRR [sensitive, ls]	102	125	0.13
LRR [sensitive, ls]	102	125	1.4
LRR [sensitive, ls]	126	149	0.0033
LRR [sensitive, ls]	126	149	0.036
LRR [sensitive, ls]	150	173	0.003
LRR [sensitive, ls]	150	173	0.033
LRR [sensitive, ls]	174	198	0.31
LRR [sensitive, ls]	174	198	3.4
LRR [sensitive, ls]	199	222	0.016
LRR [sensitive, ls]	199	222	0.18
LRR [sensitive, ls]	223	246	0.092
LRR [sensitive, ls]	223	246	1
LRR [sensitive, ls]	247	268	0.81
LRR [sensitive, ls]	247	268	8.8
LRR [sensitive, ls]	271	294	0.61
LRR [sensitive, ls]	271	294	6.7
LRR [sensitive, ls]	295	318	0.054
LRR [sensitive, ls]	295	318	0.6
LRR [sensitive, ls]	319	342	0.55
LRR [sensitive, ls]	319	342	6
LRR [sensitive, ls]	343	366	0.034
LRR [sensitive, ls]	343	366	0.38
LRR [sensitive, ls]	367	390	0.022
LRR [sensitive, ls]	367	390	0.24
LRR [sensitive, ls]	391	414	0.74
LRR [sensitive, ls]	391	414	8.1
LRR [sensitive, ls]	415	437	0.62
LRR [sensitive, ls]	415	437	6.8
LRR [sensitive, ls]	441	465	0.0069
LRR [sensitive, ls]	441	465	0.075
LRR [sensitive, ls]	488	511	0.11
LRR [sensitive, ls]	488	511	1.2
LRR [sensitive, ls]	512	535	0.007
LRR [sensitive, ls]	512	535	0.077
LRR [sensitive, ls]	536	559	0.0005
LRR [sensitive, ls]	536	559	0.0055
LRR [sensitive, ls]	584	607	0.0051
LRR [sensitive, ls]	584	607	0.056
LRR [sensitive, ls]	608	631	2.5e-06
LRR [sensitive, ls]	608	631	2.7e-05
LRR [sensitive, ls]	632	654	0.015
LRR [sensitive, ls]	632	654	0.17

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	17	668	2e-61
FLS2 [A.thaliana]	29	648	1e-87
Xa21 [O. sativa]	34	838	1e-131
Cf-9 [L. pimpinellifolium]	60	648	4e-56
Cf-9 [L. pimpinellifolium]	75	428	2e-28
Cf-9 [L. pimpinellifolium]	75	359	2e-19
Cf-9 [L. pimpinellifolium]	77	552	3e-33
FLS2 [A.thaliana]	77	263	7e-27
Cf-9 [L. pimpinellifolium]	79	712	3e-61
FLS2 [A.thaliana]	86	1042	1e-153
Cf-9 [L. pimpinellifolium]	154	664	6e-44
FLS2 [A.thaliana]	177	664	8e-70
CLV2 [A. thaliana]	343	669	5e-33
Rpg1 [Hordeum vulgare]	715	948	1e-25
Pto [L. esculentum]	740	1039	2e-34
Rpg1 [Hordeum vulgare]	746	1058	9e-23

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	693	714	out -> in

Report for 6324.m00130

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)