Report for 6324.m00132

 > 6324.m00132, length: 1107, copies: 1 

MALLLPQNCIHLVILVLLLPLMVLDGFVLGGGGNGTGGDDLSALLAFKAQLSDPLGVLATSWTRNASLCRWVGVS

CSRRRPRVVVGLRLRSVPLQGELTPHLGNLSFLRVLDLAAANLTGPIPANLGRLRRVKILDLAHNTLSDAIPSAL

GNLTKLETLNLYDNHISGHVPMELQNLYSLRVMALDQNYLTGPIPKHLFDAKHSLTHIYLGDNSLSGPIPDSVAS

LSMLRVLSLPSNQLSGPVPPAIFNMSRLETISIRKNNLTGAIPTNESFNLPMLRKIDLYMNKFTGPIPSGLASCK

HLEMISLGGNLFEDVVPAWLATLSQLKSLSLGGNELVGPIPGQLGNLSMLNMLDLSFSNLSGPIPVELGTLSQLT

FMSLSNNQLNGTFPAFIGNLSELSHLELAYNQLTGHVPSTIGNNIRPLKHFEIRGNHLHGDLSFLSSLSNSQRLE

VLIISENLFTGCIPNSVGNLSTGILEFRANNNRLIGGLPAILSNLTNLRWINFADNQLSKPILPASLMTLENLLG

FDLSKNSIAGPIPKEISMLTRLVCLFLSDNKLSGSIPDGIGNLTMLEHIHLSNNKLSSIVPTSIFHLNNLILLLL

FNNALTGALPSDLSHFQNIDHIDVSDNMLDGQLPNSYAYHPMLTYLNLSHNSFRDSIPDSFSHLTNLATLDLSYN

NLSGTIPKYLANFTYLTTLNLSFNKLEGEIPTRGVFSNITLKSLRGNAGLCGSPRLGLLPCPDKSLYSTSAHHFL

KFVLPAIIVAVAAVAICLCRMTRKKIERKPDIAGATHYRLVSYHEIVRATENFNDDNKLGAGSFGKVFKGRLRDG

MVVAIKVLNMQVEQAMRSFDVECEVLRMVRHRNLIRILSICSNLDFKALLLQYMPNGSLETYLHKEGHPPLGFLK

RLDIMLDVSMAMEHLHYHHSEVVLHCDLKPSNVLFDEEMTAHLADFGIAKLLLGDDNSAVSASMQGTLGYMAPEY

ASMGKASRKSDIFSYGIMLLEVLTRKRPTDPMFVGDMSLRKWVSDAFPARLLDVLDDRLLQGEILIQQGVLQNND

TSLPCSATWANEDLLVAVFELGLMCCSNSPAERMEINDVVVKLKRIRKDYLTCTKAI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	131	154	0.055
LRR [Pfam ls]	155	178	0.14
LRR [Pfam ls]	204	227	0.027
LRR [Pfam ls]	252	276	5.4
LRR [Pfam ls]	301	324	3.2
LRR [Pfam ls]	325	348	0.25
LRR [Pfam ls]	373	396	0.83
LRR [Pfam ls]	397	421	4.8
LRR [Pfam ls]	448	471	0.65
LRR [Pfam ls]	546	569	0.031
LRR [Pfam ls]	570	593	0.023
LRR [Pfam ls]	594	617	1.2
LRR [Pfam ls]	642	665	0.0022
LRR [Pfam ls]	666	689	0.0023
Ser/Thr pkinase [Pfam fs]	803	1005	9.9e-54
Ser/Thr pkinase [Pfam ls]	803	1041	8.3e-48

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	107	130	0.76
LRR [sensitive, ls]	107	130	8.3
LRR [sensitive, ls]	131	154	0.005
LRR [sensitive, ls]	131	154	0.055
LRR [sensitive, ls]	155	178	0.012
LRR [sensitive, ls]	155	178	0.14
LRR [sensitive, ls]	179	203	2.3
LRR [sensitive, ls]	179	203	26
LRR [sensitive, ls]	204	227	0.0025
LRR [sensitive, ls]	204	227	0.027
LRR [sensitive, ls]	228	251	0.59
LRR [sensitive, ls]	228	251	6.5
LRR [sensitive, ls]	252	276	0.49
LRR [sensitive, ls]	252	276	5.4
LRR [sensitive, ls]	277	300	1.9
LRR [sensitive, ls]	277	300	20
LRR [sensitive, ls]	301	324	0.29
LRR [sensitive, ls]	301	324	3.2
LRR [sensitive, ls]	325	348	0.022
LRR [sensitive, ls]	325	348	0.25
LRR [sensitive, ls]	349	372	1.2
LRR [sensitive, ls]	349	372	13
LRR [sensitive, ls]	373	396	0.076
LRR [sensitive, ls]	373	396	0.83
LRR [sensitive, ls]	397	421	0.44
LRR [sensitive, ls]	397	421	4.8
LRR [sensitive, ls]	422	444	4
LRR [sensitive, ls]	422	444	44
LRR [sensitive, ls]	448	471	0.059
LRR [sensitive, ls]	448	471	0.65
LRR [sensitive, ls]	473	496	3
LRR [sensitive, ls]	473	496	33
LRR [sensitive, ls]	497	521	1
LRR [sensitive, ls]	497	521	11
LRR [sensitive, ls]	522	545	2.7
LRR [sensitive, ls]	522	545	29
LRR [sensitive, ls]	546	569	0.0029
LRR [sensitive, ls]	546	569	0.031
LRR [sensitive, ls]	570	593	0.0021
LRR [sensitive, ls]	570	593	0.023
LRR [sensitive, ls]	594	617	0.11
LRR [sensitive, ls]	594	617	1.2
LRR [sensitive, ls]	618	641	2.6
LRR [sensitive, ls]	618	641	28
LRR [sensitive, ls]	642	665	0.0002
LRR [sensitive, ls]	642	665	0.0022
LRR [sensitive, ls]	666	689	0.00021
LRR [sensitive, ls]	666	689	0.0023
LRR [sensitive, ls]	690	715	0.66
LRR [sensitive, ls]	690	715	7.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	12	891	1e-120
CLV2 [A. thaliana]	40	681	3e-56
FLS2 [A.thaliana]	40	706	2e-89
CLV2 [A. thaliana]	47	566	3e-37
Cf-9 [L. pimpinellifolium]	61	706	2e-61
Cf-9 [L. pimpinellifolium]	76	317	3e-20
Cf-9 [L. pimpinellifolium]	80	389	1e-30
FLS2 [A.thaliana]	87	1097	1e-152
Cf-9 [L. pimpinellifolium]	89	729	4e-58
Cf-9 [L. pimpinellifolium]	169	707	8e-43
CLV2 [A. thaliana]	232	706	2e-47
FLS2 [A.thaliana]	298	722	3e-47
CLV2 [A. thaliana]	353	722	4e-30
Rpg1 [Hordeum vulgare]	789	1001	6e-22
Pto [L. esculentum]	795	1057	9e-34
Rpg1 [Hordeum vulgare]	800	1001	3e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	12	34	in -> out
putative TM domain	752	769	out -> in

Report for 6324.m00132

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)