Report for 6324.m00144

 > 6324.m00144, length: 1102, copies: 1 

MAFRMPVRISVVLLIIALSAVTCASAVPSKSNGSDTDYAALLAFKAQLADPLGILASNWTVNTPFCRWVGIRCGR

RHQRVTGLVLPGIPLQGELSSHLGNLSFLSVLNLTNASLTGSVPEDIGRLHRLEILELGYNSLSGGIPATIGNLT

RLRVLYLEFNQLSGSIPAELQGLGSIGLMSLRRNYLTGSIPNNLFNNTPLLAYFNIGNNSLSGSIPASIGSLSML

EHLNMQVNLLAGPVPPGIFNMSTLRVIALGLNTFLTGPIAGNTSFNLPALQWLSIDGNNFTGQIPLGLASCQYLQ

VLSLSENYFEGVVTASAAWLSKLTNLTILVLGMNHFDAGPIPASLSNLTMLSVLDLSWSNLTGAIPPEYGQLGKL

EKLHLSQNQLTGTIPASLGNMSELAMLVLEGNLLNGSLPTTVGSIRSLSVLDIGANRLQGGLEFLSALSNCRELY

FLSIYSNYLTGNLPNYVGNLSSTLRLFSLHGNKLAGELPTTISNLTGLLVLDLSNNQLHGTIPESIMEMENLLQL

DLSGNSLAGSVPSNAGMLKSVEKIFLQSNKFSGSLPEDMGNLSKLEYLVLSDNQLSSNVPPSLSRLNSLMKLDLS

QNFLSGVLPVGIGDLKQINILDLSTNHFTGSLSDSIGQLQMITYLNLSVNLFNGSLPDSFANLTGLQTLDLSHNN

ISGTIPKYLANFTILISLNLSFNNLHGQIPKGGVFSNITLQSLVGNSGLCGVAHLGLPPCQTTSPKRNGHKLKYL

LPAITIVVGAFAFSLYVVIRMKVKKHQMISSGMVDMISNRLLSYHELVRATDNFSYDNMLGAGSFGKVYKGQLSS

SLVVAIKVIHQHLEHAMRSFDAECHVLRMARHRNLIKILNTCTNLDFRALILEYMPNGSLEALLHSEGRMQLGFL

ERVDIMLDVSMAMEYLHHEHHEVVLHCDLKPSNVLLDDDMTAHVSDFGIARLLLGDDSSMISASMPGTVGYMAPE

YGALGKASRKSDVFSYGIMLLEVFTGKRPTDAMFVGELNIRQWVYQAFPVELVHVLDTRLLQDCSSPSSLHGFLV

PVFELGLLCSADSPEQRMAMSDVVVTLKKIRKDYVKSISTTGSVALPAYTKE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	4.2
LRR [Pfam ls]	127	150	0.036
LRR [Pfam ls]	151	174	0.0074
LRR [Pfam ls]	274	297	2.6
LRR [Pfam ls]	374	397	0.0024
LRR [Pfam ls]	422	444	4.5
LRR [Pfam ls]	473	496	2.1
LRR [Pfam ls]	497	520	0.29
LRR [Pfam ls]	521	544	3.6
LRR [Pfam ls]	545	568	3.4
LRR [Pfam ls]	569	592	0.057
LRR [Pfam ls]	593	616	2.6
LRR [Pfam ls]	641	664	2.4
LRR [Pfam fs]	665	688	3.1e-05
LRR [Pfam ls]	665	688	0.00052
Ser/Thr pkinase [Pfam fs]	804	1006	1.4e-52
Ser/Thr pkinase [Pfam ls]	804	1053	2.4e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	103	126	0.38
LRR [sensitive, ls]	103	126	4.2
LRR [sensitive, ls]	127	150	0.0033
LRR [sensitive, ls]	127	150	0.036
LRR [sensitive, ls]	151	174	0.00068
LRR [sensitive, ls]	151	174	0.0074
LRR [sensitive, ls]	175	199	0.52
LRR [sensitive, ls]	175	199	5.7
LRR [sensitive, ls]	200	223	0.6
LRR [sensitive, ls]	200	223	6.5
LRR [sensitive, ls]	224	247	5.5
LRR [sensitive, ls]	224	247	60
LRR [sensitive, ls]	274	297	0.23
LRR [sensitive, ls]	274	297	2.6
LRR [sensitive, ls]	298	324	1.1
LRR [sensitive, ls]	298	324	12
LRR [sensitive, ls]	325	349	2.6
LRR [sensitive, ls]	325	349	28
LRR [sensitive, ls]	350	373	0.88
LRR [sensitive, ls]	350	373	9.6
LRR [sensitive, ls]	374	397	0.00022
LRR [sensitive, ls]	374	397	0.0024
LRR [sensitive, ls]	398	421	6.9
LRR [sensitive, ls]	398	421	75
LRR [sensitive, ls]	422	444	0.41
LRR [sensitive, ls]	422	444	4.5
LRR [sensitive, ls]	448	471	0.55
LRR [sensitive, ls]	448	471	6
LRR [sensitive, ls]	473	496	0.19
LRR [sensitive, ls]	473	496	2.1
LRR [sensitive, ls]	497	520	0.027
LRR [sensitive, ls]	497	520	0.29
LRR [sensitive, ls]	521	544	0.33
LRR [sensitive, ls]	521	544	3.6
LRR [sensitive, ls]	545	568	0.31
LRR [sensitive, ls]	545	568	3.4
LRR [sensitive, ls]	569	592	0.0052
LRR [sensitive, ls]	569	592	0.057
LRR [sensitive, ls]	593	616	0.24
LRR [sensitive, ls]	593	616	2.6
LRR [sensitive, ls]	617	640	0.52
LRR [sensitive, ls]	617	640	5.7
LRR [sensitive, ls]	641	664	0.22
LRR [sensitive, ls]	641	664	2.4
LRR [sensitive, ls]	665	688	4.8e-05
LRR [sensitive, ls]	665	688	0.00052
LRR [sensitive, ls]	689	711	1.6
LRR [sensitive, ls]	689	711	17

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	7	585	3e-70
FLS2 [A.thaliana]	9	706	1e-88
CLV2 [A. thaliana]	37	725	3e-59
Cf-9 [L. pimpinellifolium]	58	726	3e-76
FLS2 [A.thaliana]	90	1081	1e-155
Xa21 [O. sativa]	208	892	1e-117
FLS2 [A.thaliana]	302	721	1e-56
CLV2 [A. thaliana]	354	726	4e-35
Xa21 [O. sativa]	479	695	9e-28
Xa21 [O. sativa]	501	705	5e-28
Xa21 [O. sativa]	522	722	6e-29
Rpg1 [Hordeum vulgare]	781	1002	2e-27
Pto [L. esculentum]	788	1078	9e-32
Rpg1 [Hordeum vulgare]	801	1002	2e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out
putative TM domain	750	769	out -> in

Report for 6324.m00144

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)