Report for 6342.m00181

 > 6342.m00181, length: 1061, copies: 1 

MASCRRPAPLRLVVFLAIVLLRWSTNGNATAGGDDALRGDALALVRLRASLRCHAHALRDWSAGNVAAVCAWTGV

RCAGGRVVSVDVANMNVSTGAPVSAAVAGLDALANLSLAGNGIVGAVTASALPALRFVNVSGNQLGGGLDGWDFA

SLPSLEVFDAYDNNFSSPLPAGVVALRRLRYLDLGGNFFSGEIPAAYGGMAALEYLSLNGNNLQGAIPPELGNLT

SLRELYLGYYNVFDGGIPPELGRLRNLTMLDISNCGLSGRIPPELGALAALDTLFLHTNQLSGAIPPELGNLTAL

TALDLSNNALTGEVPATLASLTSLRLLNLFLNRLHGPVPDFVAALPRLETVQLFMNNLTGRVPAGLGANAALRLV

DISSNRLTGMVPEMLCASGELHTAILMNNFLFGPIPASLGSCSSLTRVRLGQNYLNGTIPAGLLYLPRLNLLELQ

NNLLSGDVPANPSPAMAAASQSSQLAQLNLSSNQLSGPLPSSIANLTALQTLLVSNNRLAGAVPPEVGELRRLVK

LDLSGNALSGTIPAAIGRCGELTYLDLSKNNLSGAIPEAIAGVRVLNYLNLSRNQLEEAIPAAIGAMSSLTAADF

SYNDLSGELPDAGQLGYLNATAFAGNPRLCGPLLGRPCGYGGGGAAAVGAGGSSSAPVVTTRQRAAGGDFKLVLA

LGLLVCSVVFAAAAVLRARSCRGGGGPDGGGAWRFTAFHKVDFGIAEVIESMKDGNVVGRGGAGVVYVGRTRSGG

SIAVKRLNTSSSAAAAGGGEAARHDHGFRAEIRTLGSIRHRNIVRLLAFCSRRGGSGGGEAASSSNVLVYEYMAN

GSLGEVLHGKGGGFLSWDRRYRIAVEAARGLCYLHHDCSPMIVHRDVKSNNILLGDNFEAHVADFGLAKFLRSGG

GATASSECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWTKRVTDGRRES

VHRIIDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSEFPRHGSDQPSPSSSAPETGEESSPEKEP

NCYKLFPDLLT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	129	153	2
LRR [Pfam ls]	178	201	0.35
LRR [Pfam ls]	202	225	0.0013
LRR [Pfam ls]	251	274	0.0091
LRR [Pfam ls]	275	298	0.66
LRR [Pfam ls]	299	322	0.043
LRR [Pfam ls]	323	346	4.9
LRR [Pfam ls]	371	394	4.6
LRR [Pfam ls]	474	497	0.055
LRR [Pfam ls]	522	545	0.068
LRR [Pfam ls]	546	569	0.023
LRR [Pfam ls]	570	593	1.4
Ser/Thr pkinase [Pfam fs]	727	951	5.9e-45
Ser/Thr pkinase [Pfam ls]	727	997	2.1e-40

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	129	153	0.18
LRR [sensitive, ls]	129	153	2
LRR [sensitive, ls]	154	177	2.6
LRR [sensitive, ls]	154	177	28
LRR [sensitive, ls]	178	201	0.032
LRR [sensitive, ls]	178	201	0.35
LRR [sensitive, ls]	202	225	0.00012
LRR [sensitive, ls]	202	225	0.0013
LRR [sensitive, ls]	226	250	0.89
LRR [sensitive, ls]	226	250	9.8
LRR [sensitive, ls]	251	274	0.00083
LRR [sensitive, ls]	251	274	0.0091
LRR [sensitive, ls]	275	298	0.06
LRR [sensitive, ls]	275	298	0.66
LRR [sensitive, ls]	299	322	0.0039
LRR [sensitive, ls]	299	322	0.043
LRR [sensitive, ls]	323	346	0.45
LRR [sensitive, ls]	323	346	4.9
LRR [sensitive, ls]	371	394	0.42
LRR [sensitive, ls]	371	394	4.6
LRR [sensitive, ls]	419	442	0.61
LRR [sensitive, ls]	419	442	6.7
LRR [sensitive, ls]	443	463	0.91
LRR [sensitive, ls]	443	463	10
LRR [sensitive, ls]	474	497	0.005
LRR [sensitive, ls]	474	497	0.055
LRR [sensitive, ls]	498	521	0.52
LRR [sensitive, ls]	498	521	5.7
LRR [sensitive, ls]	522	545	0.0062
LRR [sensitive, ls]	522	545	0.068
LRR [sensitive, ls]	546	569	0.0021
LRR [sensitive, ls]	546	569	0.023
LRR [sensitive, ls]	570	593	0.13
LRR [sensitive, ls]	570	593	1.4
LRR [sensitive, ls]	594	616	4.5
LRR [sensitive, ls]	594	616	49

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	9	833	4e-75
CLV2 [A. thaliana]	40	638	1e-52
FLS2 [A.thaliana]	58	610	1e-73
Cf-9 [L. pimpinellifolium]	59	618	2e-45
Cf-9 [L. pimpinellifolium]	82	563	2e-37
Cf-9 [L. pimpinellifolium]	85	586	1e-45
FLS2 [A.thaliana]	98	1020	1e-107
FLS2 [A.thaliana]	238	612	4e-49
FLS2 [A.thaliana]	239	611	1e-56
Pto [L. esculentum]	720	1020	3e-33
Rpg1 [Hordeum vulgare]	720	1055	2e-31
Rpg1 [Hordeum vulgare]	723	1022	7e-20

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6342.m00181

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)