Report for 6595.m00261

 > 6595.m00261, length: 342, copies: 1 

MANATVVASSWIPLLCLVVVVLSACTAVSSAVECNGDDRAALLRVKAQLGDPVRLSSWRPSTNCCAWEPAVFCSG

EPGRVTGLALFSLAGVAAPVPPALGELTGLAVLQIASVRGMSGPIPPSFANLSLLEDLDITGTSISGPVPASYLA

GATNLRTLVIADSRLAGPIPPSLAGDHPNLRYLDLSGNFLTGAIPPGLVHGSFRFLILSHNQLTGEIPRCYGDVD

TVDLSHNRLTGDPSPHLFGIAAPAAKIDLSWNELAFDMTGVRFPHHLRYLDLSHNRITGKVAKSLMDVRLEHLNV

SDNELCGEIPAGRFMAAHGADCYARNRCLCGAPLPPCCDGGL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	179	199	0.0027
LRR [Pfam ls]	271	291	0.21
LRR [Pfam ls]	294	318	0.76

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	129	153	0.83
LRR [sensitive, ls]	129	153	21
LRR [sensitive, ls]	154	178	0.82
LRR [sensitive, ls]	154	178	21
LRR [sensitive, ls]	179	199	0.00011
LRR [sensitive, ls]	179	199	0.0027
LRR [sensitive, ls]	202	222	0.46
LRR [sensitive, ls]	202	222	12
LRR [sensitive, ls]	223	247	0.35
LRR [sensitive, ls]	223	247	8.9
LRR [sensitive, ls]	271	291	0.0082
LRR [sensitive, ls]	271	291	0.21
LRR [sensitive, ls]	294	318	0.03
LRR [sensitive, ls]	294	318	0.76

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	12	218	1e-13
CLV2 [A. thaliana]	27	310	1e-11
FLS2 [A.thaliana]	29	314	3e-19
CLV2 [A. thaliana]	73	310	3e-11
Xa21 [O. sativa]	78	310	6e-11
CLV2 [A. thaliana]	82	310	5e-12
FLS2 [A.thaliana]	90	337	8e-20
Xa21 [O. sativa]	91	337	3e-13
Cf-9 [L. pimpinellifolium]	96	340	1e-11
FLS2 [A.thaliana]	100	311	8e-17

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out

Report for 6595.m00261

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)