Report for 6597.m00145

 > 6597.m00145, length: 791, copies: 1 

MAAVPAGGQPSDGVVIAQADLQGLQAIRQALVDPRGFLRGWNGTGLDACSGGWAGIKCAQGKVVAIQLPFKGLAG

ALSDKVGQLTALRKLSLHDNALGGQLPASLGFLPELRGVYLFNNRFAGAVPPQLGGCALLQTLDLSGNFLSGAVP

ASLANATRLLRLNLAYNNLTGAVPSSLTSLPFLVSLQLSSNNLSGEVPPTIGNLRMLHELSLSYNLISGSIPDGI

GSLSGLHSLDLSNNLLSGSLPASLCNLTSLVELKLDGNDIGGHIPDAIDGLKNLTKLSLRRNVLDGEIPATVGNI

SALSLLDVSENNLTGGIPESLSGLNNLTSFNVSYNNLSGPVPVALSSKFNASSFAGNIQLCGYNGSAICTSISSP

ATMASPPVPLSQRPTRKLNKRELIFAVGGICLLFLLLFCCVLLFWRKDKQESESPKKGAKDATAKAAAGKSGGGG

GGSGGAGGDGGGKLVHFDGPLSFTADDLLCATAEILGKSTYGTVYKATMENGTFVAVKRLREKIAKNQKEFEAEV

NALGKLRHPNLLALRAYYLGPKGEKLLVFDFMTKGNLTSFLHARAPDSPVDWPTRMNIAMGVARGLHHLHAEASI

VHGNLTSNNILLDEGNDARIADCGLSRLMNATANSNVIAAAGALGYRAPELSKLKKANAKTDIYSLGMIMLELLT

GKSPGDTTNGLDLPQWVASVVEEEWTNEVFDLELMKDAAAAGSETGEELVKTLKLALHCVDPSPAARPEAQQVLR

QLEQIKPSVAVSASSSFTGEPSQTTATATTITDDTKSTITE

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	86	109	1.4
LRR [Pfam ls]	134	157	0.3
LRR [Pfam ls]	158	181	0.28
LRR [Pfam ls]	182	205	0.13
LRR [Pfam ls]	206	229	0.28
LRR [Pfam ls]	230	253	0.011
LRR [Pfam ls]	254	277	0.094
LRR [Pfam ls]	302	325	0.1
Ser/Thr pkinase [Pfam ls]	480	755	2.2e-31
Ser/Thr pkinase [Pfam fs]	490	679	6.7e-35

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	86	109	0.044
LRR [sensitive, ls]	86	109	1.4
LRR [sensitive, ls]	110	133	1.3
LRR [sensitive, ls]	110	133	42
LRR [sensitive, ls]	134	157	0.0096
LRR [sensitive, ls]	134	157	0.3
LRR [sensitive, ls]	158	181	0.009
LRR [sensitive, ls]	158	181	0.28
LRR [sensitive, ls]	182	205	0.0043
LRR [sensitive, ls]	182	205	0.13
LRR [sensitive, ls]	206	229	0.0089
LRR [sensitive, ls]	206	229	0.28
LRR [sensitive, ls]	230	253	0.00034
LRR [sensitive, ls]	230	253	0.011
LRR [sensitive, ls]	254	277	0.003
LRR [sensitive, ls]	254	277	0.094
LRR [sensitive, ls]	278	301	0.29
LRR [sensitive, ls]	278	301	9
LRR [sensitive, ls]	302	325	0.0033
LRR [sensitive, ls]	302	325	0.1
LRR [sensitive, ls]	326	349	0.32
LRR [sensitive, ls]	326	349	10

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	12	350	2e-37
FLS2 [A.thaliana]	18	360	5e-51
CLV2 [A. thaliana]	20	347	1e-30
Cf-9 [L. pimpinellifolium]	41	359	2e-23
Cf-9 [L. pimpinellifolium]	50	378	2e-29
FLS2 [A.thaliana]	58	342	1e-42
CLV2 [A. thaliana]	60	364	8e-33
CLV2 [A. thaliana]	62	342	4e-32
FLS2 [A.thaliana]	62	756	2e-88
CLV2 [A. thaliana]	63	361	4e-30
FLS2 [A.thaliana]	63	361	1e-38
Xa21 [O. sativa]	63	319	9e-38
Cf-9 [L. pimpinellifolium]	66	357	4e-18
CLV2 [A. thaliana]	66	342	2e-37
Xa21 [O. sativa]	66	347	2e-38
Cf-9 [L. pimpinellifolium]	73	342	2e-27
FLS2 [A.thaliana]	73	342	4e-41
FLS2 [A.thaliana]	73	342	4e-38
Xa21 [O. sativa]	87	572	9e-47
CLV2 [A. thaliana]	125	360	1e-20
Xa21 [O. sativa]	158	354	2e-34
CLV2 [A. thaliana]	164	348	5e-17
Rpg1 [Hordeum vulgare]	483	755	2e-22
Rpg1 [Hordeum vulgare]	485	755	4e-30
Pto [L. esculentum]	486	753	2e-29

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	398	420	in -> out

Report for 6597.m00145

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)