Report for 6608.m00160

 > 6608.m00160, length: 251, copies: 1 

MRGNQLSSLPSSIGRLLNLEELDVGSNGLSSLPDSIGSLTRLKKLIVETNDLDELPYTIGHCVSLVELQAGYNHL

KALPEAVGKLEPLEILSVRYNNLRSLPTTMASLTKLKEVDVSFNELESIPENFCFATSLIKLNVGNNFADLQYLP

RSIGNLEMLEELDMSNNQIRVLPDSFGNLKHLRVLRAEENPLQVPPRDIALKGAQAVVQYMSDASKRTTKSEPMK

PKKTWVHFCFFSRPNKRKHDRIDNAT

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	18	40	0.0087
LRR [Pfam ls]	64	86	6
LRR [Pfam ls]	110	132	0.18
LRR [Pfam ls]	158	180	0.0027

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	18	40	0.00033
LRR [sensitive, ls]	18	40	0.0087
LRR [sensitive, ls]	41	63	2.4
LRR [sensitive, ls]	41	63	63
LRR [sensitive, ls]	64	86	0.23
LRR [sensitive, ls]	64	86	6
LRR [sensitive, ls]	87	109	0.62
LRR [sensitive, ls]	87	109	16
LRR [sensitive, ls]	110	132	0.0067
LRR [sensitive, ls]	110	132	0.18
LRR [sensitive, ls]	133	157	0.89
LRR [sensitive, ls]	133	157	24
LRR [sensitive, ls]	158	180	0.0001
LRR [sensitive, ls]	158	180	0.0027
LRR [sensitive, ls]	181	202	0.85
LRR [sensitive, ls]	181	202	22

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	3	195	3e-17
FLS2 [A.thaliana]	7	199	2e-12
FLS2 [A.thaliana]	9	208	1e-10
Xa21 [O. sativa]	18	192	1e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6608.m00160

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)