Report for 6622.m00170

 > 6622.m00170, length: 993, copies: 1 

MANKRYVNFFLFFVISFSLLHKSYPKSTNQSNEEHQILLELKNHWGSSPALGRWNSTTTAHCNWEGITCTNGAVI

GISLPNQTFIKPIPPSICLLKNLTRLDLSYNNFSTSFPTMLYNCSNLKFLDLSNNAFDGQLPSDLNHLSALLEHL

NLSSNHFTGRIPPSIGLFPRLKSLLLDTNQFDGRYPAEDISNLADLERLTLAVNPFVPAPFPVEFGRLTRLTYLW

LSNMNITGEIPENLSSLRELNLLDFSSNKLQGKIPTWIWQHKKLQNLYLYANGFTGEIEPNVSALNLVEIDVSSN

ELIGTIPNGFGKLTNLTLLFLYFNKLSGSIPPSVGLLPKLTDIRLFGNMLSGSLPPELGKHSPLANLEVSNNNLS

GKLPEGLCFNRKLYDIVVFNNSFSGKLPSSLDGCYLLNNLMMYNNNFSGEFPKSLWSVVTNQLSTVMIQNNRFSG

TFPKQLPWNFTRLDISNNKFSGPIPTLAGKMKVFIAANNLLSGEIPWDLTGISQVTEVDLSRNQISGSLPMTIGV

LARLNTLNLSGNQISGNIPAAFGFMTVLTILDLSSNKLSGEIPKDFNKLRLNFLNLSMNQLIGEIPISLQNEAYE

QSFLFNPGLCVSSNNSVHNFPICRARTNGNDLFRRLIALFSAVASIMLLGSAVLGIMLLRRKKLQDHLSWKLTPF

HILHFTTTNILSGLYEQNWIGSGRSGKVYRVYAGDRASGGRMVAVKKIWNTPNLDDKLEKDFLAEAQILGEIRHT

NIVKLLCCISSSDAKLLVYEYMENGSLHQWLHQRERIGAPGPLDWPTRLQIAIDSARGLCYMHHHCSPPIVHRDV

KCANILLDHNFRAKMADFGLAKILLKAGDDESFSAIAGTFGYMAPEYGHRLKVNEKIDVYSFGVVLLEIITGRVA

NDGGEYYCLAQWAWRQYQEYGLSVDLLDEGIRDPTHVEDALEVFTLAVICTGEHPSMRPSMKDVLHVLLRFDRKS

NGGILQDDICDETALLES

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	97	120	0.19
LRR [Pfam ls]	121	144	0.02
LRR [Pfam ls]	146	169	0.069
LRR [Pfam ls]	220	243	0.042
LRR [Pfam ls]	268	288	8.4
LRR [Pfam ls]	291	314	0.035
LRR [Pfam ls]	315	338	0.032
LRR [Pfam ls]	339	362	1.9
LRR [Pfam ls]	459	482	0.6
LRR [Pfam ls]	504	527	6.6
LRR [Pfam ls]	528	551	0.012
LRR [Pfam ls]	552	575	0.012
Ser/Thr pkinase [Pfam ls]	690	970	6.5e-42
Ser/Thr pkinase [Pfam fs]	695	906	3.5e-47

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	97	120	0.0092
LRR [sensitive, ls]	97	120	0.19
LRR [sensitive, ls]	121	144	0.00098
LRR [sensitive, ls]	121	144	0.02
LRR [sensitive, ls]	146	169	0.0033
LRR [sensitive, ls]	146	169	0.069
LRR [sensitive, ls]	170	194	2.2
LRR [sensitive, ls]	170	194	46
LRR [sensitive, ls]	195	219	6
LRR [sensitive, ls]	195	219	120
LRR [sensitive, ls]	220	243	0.002
LRR [sensitive, ls]	220	243	0.042
LRR [sensitive, ls]	244	267	0.52
LRR [sensitive, ls]	244	267	11
LRR [sensitive, ls]	268	288	0.4
LRR [sensitive, ls]	268	288	8.4
LRR [sensitive, ls]	291	314	0.0017
LRR [sensitive, ls]	291	314	0.035
LRR [sensitive, ls]	315	338	0.0015
LRR [sensitive, ls]	315	338	0.032
LRR [sensitive, ls]	339	362	0.093
LRR [sensitive, ls]	339	362	1.9
LRR [sensitive, ls]	363	387	0.56
LRR [sensitive, ls]	363	387	12
LRR [sensitive, ls]	411	435	0.64
LRR [sensitive, ls]	411	435	13
LRR [sensitive, ls]	437	457	1.9
LRR [sensitive, ls]	437	457	39
LRR [sensitive, ls]	459	482	0.029
LRR [sensitive, ls]	459	482	0.6
LRR [sensitive, ls]	504	527	0.32
LRR [sensitive, ls]	504	527	6.6
LRR [sensitive, ls]	528	551	0.00059
LRR [sensitive, ls]	528	551	0.012
LRR [sensitive, ls]	552	575	0.00057
LRR [sensitive, ls]	552	575	0.012

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	9	616	7e-56
Xa21 [O. sativa]	11	782	5e-71
FLS2 [A.thaliana]	12	594	6e-68
Cf-9 [L. pimpinellifolium]	47	569	5e-53
FLS2 [A.thaliana]	77	204	1e-13
Cf-9 [L. pimpinellifolium]	88	609	5e-55
Cf-9 [L. pimpinellifolium]	88	385	1e-22
FLS2 [A.thaliana]	88	976	6e-98
Cf-9 [L. pimpinellifolium]	94	569	2e-39
Rpg1 [Hordeum vulgare]	683	981	1e-22
Rpg1 [Hordeum vulgare]	684	972	2e-15
Pto [L. esculentum]	694	965	1e-32

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	637	659	out -> in

Report for 6622.m00170

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)