Report for 6644.m00181

 > 6644.m00181, length: 965, copies: 1 

MAERRPCYCRNNGFLLLLVQVLLFLFLFLDSSMVATAASAPAPLNTTQVSIMKELSGLVTASAKWNTSDSNPCRW

DGVSCSSSSNSISVVTNLTLSGYGLSNSTIFATICSLDTLQILDLSKNSFTNSIEQFFTSSCSMKAGLRSLNLSS

SQLSMPLSNFSGFPLLEVLDLSFNSFSGDVRTQLSSLLKLRSLNLSSNNLAGDVPTSMTPSLEELVLSINNFSGS

IPIALFNYQNLTMLDLSQNNLNGDVPDEFLKLPKLKTLLLSGNQLSGNIPVSVSNVASLARFAANQNNFTGFIPS

GITKNVKMLDLSYNELSGVIPSDILSPVGLWTVDLTHNKLEGPIPSSLSPTLYRLRLGGGNSLNGTIPATIGDAS

TLAYLELDSNQLTGSIPLELGRCKSLSLLNLASNKFQGPVPDAISSLDKLVVLKLQMNNLDGPIPSVFSNLTSLI

TLNLSGNSFTGGIPREIGKLPKLSILNLQCNKISGTIPDSLHLLTSLIELNLGNNILTGTIPTMPTKLSTVLNLS

HNNLSGSIPSNIDLLSDLEILDLSYNNLYGEVPASLAKLESLTQLVLSYNHLSGSIPIFRQHVDIATNGNPDLTN

GTRNYDNAPTSGKRRTHNTVIIVVAITGALVGLCLLAAIVTISYSKRIYRVEDEGPSTEDVARIINGHLITMNSI

HTSAIDFVKAMEAVSNHSNIFLKTRFCTYYKAVMPNGSTYSLKQINCSDKIFQIGSQGKVAHELEVLGKLSNSNV

MVPLAYVLTEDNAYIIYEHVHKGTVFDFLHAGRSDVLDWPSRYSIAFGLAQGLTFLHGCTQPVLLLDLSTRTVHL

KSMNEPQIGDVELYKIVDTLKSSGSLSTIAGTVGYIPPEYAYTMRLTMAGNVYSFGVILLELLTGKPSVSDGIEL

AKWALSLSGSPDQREQILDTRVSRTSAAVHSQMLSVLNIALACVALSPDARPKMRTVLRMLFNAK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	114	136	3.4
LRR [Pfam ls]	142	164	1.5
LRR [Pfam ls]	189	209	1.1
LRR [Pfam ls]	235	258	0.012
LRR [Pfam ls]	259	283	1.1
LRR [Pfam ls]	305	328	1.6
LRR [Pfam ls]	376	399	0.7
LRR [Pfam ls]	400	423	0.51
LRR [Pfam ls]	424	447	1.8
LRR [Pfam ls]	448	471	0.0087
LRR [Pfam ls]	472	495	0.059
LRR [Pfam ls]	518	541	6.1
LRR [Pfam ls]	542	565	0.28
LRR [Pfam ls]	566	588	0.87
Ser/Thr pkinase [Pfam ls]	701	963	2.1e-09
Ser/Thr pkinase [Pfam fs]	738	809	0.0071
Ser/Thr pkinase [Pfam fs]	877	893	0.024

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	114	136	0.15
LRR [sensitive, ls]	114	136	3.4
LRR [sensitive, ls]	142	164	0.066
LRR [sensitive, ls]	142	164	1.5
LRR [sensitive, ls]	165	188	0.46
LRR [sensitive, ls]	165	188	10
LRR [sensitive, ls]	189	209	0.047
LRR [sensitive, ls]	189	209	1.1
LRR [sensitive, ls]	211	234	0.29
LRR [sensitive, ls]	211	234	6.5
LRR [sensitive, ls]	235	258	0.00054
LRR [sensitive, ls]	235	258	0.012
LRR [sensitive, ls]	259	283	0.05
LRR [sensitive, ls]	259	283	1.1
LRR [sensitive, ls]	305	328	0.071
LRR [sensitive, ls]	305	328	1.6
LRR [sensitive, ls]	329	352	0.49
LRR [sensitive, ls]	329	352	11
LRR [sensitive, ls]	376	399	0.031
LRR [sensitive, ls]	376	399	0.7
LRR [sensitive, ls]	400	423	0.023
LRR [sensitive, ls]	400	423	0.51
LRR [sensitive, ls]	424	447	0.082
LRR [sensitive, ls]	424	447	1.8
LRR [sensitive, ls]	448	471	0.00039
LRR [sensitive, ls]	448	471	0.0087
LRR [sensitive, ls]	472	495	0.0026
LRR [sensitive, ls]	472	495	0.059
LRR [sensitive, ls]	496	515	0.4
LRR [sensitive, ls]	496	515	9
LRR [sensitive, ls]	518	541	0.27
LRR [sensitive, ls]	518	541	6.1
LRR [sensitive, ls]	542	565	0.012
LRR [sensitive, ls]	542	565	0.28
LRR [sensitive, ls]	566	588	0.039
LRR [sensitive, ls]	566	588	0.87

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	15	581	1e-57
Cf-9 [L. pimpinellifolium]	62	586	3e-50
Xa21 [O. sativa]	63	785	4e-72
Cf-9 [L. pimpinellifolium]	65	582	1e-47
FLS2 [A.thaliana]	73	607	1e-57
Cf-9 [L. pimpinellifolium]	78	590	6e-44
FLS2 [A.thaliana]	81	512	2e-52
FLS2 [A.thaliana]	104	582	9e-66
FLS2 [A.thaliana]	107	965	4e-87
CLV2 [A. thaliana]	111	471	7e-37
CLV2 [A. thaliana]	140	583	1e-44
Cf-9 [L. pimpinellifolium]	211	607	2e-42
FLS2 [A.thaliana]	380	611	3e-24
Pto [L. esculentum]	673	958	4e-21
Rpg1 [Hordeum vulgare]	679	963	2e-18
Rpg1 [Hordeum vulgare]	680	961	2e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	35	in -> out
putative TM domain	620	642	out -> in

Report for 6644.m00181

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)