Report for 6651.m00113

 > 6651.m00113, length: 915, copies: 1 

MEYHNTTDENILLAFKAGLSNQSDVLSSWKKSTDFCQWPGVLCSLKHKHRVTVLNLSSESLAGTISPSIGNLTFL

KILDLSGEQFGWASVLNQTTSPEKSLLGLEPYQVSSSYTCRRTSFTGSIPTSLANLSSLQEIYLTMNQLEGTIPE

GFGRLSGLKNIHLGVNHLSGMIPTSIFNISSLSCFGVPMNQLHGLLPSDLGIHLPKLQYLLLGYNHFTGSLPASI

ANSTEIYSLDISFNNFSGSIPPEIGTLCPDFLSFDTNQLIATTAEDWKFMTFLTNCTRLRILDLQDNMLGGVLPT

SVSNLSAQLQLLYVGFNKISGNIPFGISNLVGLNQLQLANNQFTGTLPDNIGRLSFLHLLGIENNLLTGFIPSSV

GNLTQLLRLSMDNNMLEGPLPTSIGNLQKITLALFARNKFTGPLPREIFTYLPVICSVGSLTNLAYLYISSNNLS

GPLPNELSNCQSLIDLRLDQNLFSGNIPETLSKLRGLTSLTLTKNTLSGVIPQELGLMDGMKELYLAHNNLSGHI

PVSIGNMTSLNRLDLSFNHLDGEVPSKGVLSNMTGKKPKAQSKKTIGFQLIDDKYPRVSYAELVQGTNGFATDSL

MGRGRYGSVYKCGLLLKSMMTTVAVKVFDLQQSGSSKSFLAECEALSKIRHRNLINVITCCSSTDIKQNDFKAIV

FEFMPNGSLDRWLHLDVTASQPPQGLTLIQRLNIAVDVADALDYLHNNCDPPIVHCDLKPSNILLDEDLVAHVGD

FGLAKILADSEGEQPINSKSSIGIRGTIGYVAPEYGEGGQVSPCGDAYSFGIVILELFTGMVPTHDMFRDGLTLQ

KHVKNVFPGILMKIVDPILLSIEGVYTSNLPPGRNAMEHMNHAILSIMKIALSCSRQAPTERMRIRDAAADLRRV

RDSHAKWRDHNARRV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	133	156	0.91
LRR [Pfam ls]	206	229	0.47
LRR [Pfam ls]	230	253	0.92
LRR [Pfam ls]	283	306	0.069
LRR [Pfam ls]	308	331	0.83
LRR [Pfam ls]	332	355	1.3
LRR [Pfam ls]	356	379	0.83
LRR [Pfam ls]	380	403	3.8
LRR [Pfam ls]	438	461	0.22
LRR [Pfam ls]	462	485	4.9
LRR [Pfam ls]	510	533	0.13
LRR [Pfam ls]	534	559	1.1
Ser/Thr pkinase [Pfam fs]	595	816	5.9e-47
Ser/Thr pkinase [Pfam ls]	595	893	2.1e-38

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	50	73	4.2
LRR [sensitive, ls]	50	73	46
LRR [sensitive, ls]	133	156	0.083
LRR [sensitive, ls]	133	156	0.91
LRR [sensitive, ls]	157	180	1.8
LRR [sensitive, ls]	157	180	19
LRR [sensitive, ls]	206	229	0.043
LRR [sensitive, ls]	206	229	0.47
LRR [sensitive, ls]	230	253	0.084
LRR [sensitive, ls]	230	253	0.92
LRR [sensitive, ls]	283	306	0.0063
LRR [sensitive, ls]	283	306	0.069
LRR [sensitive, ls]	308	331	0.075
LRR [sensitive, ls]	308	331	0.83
LRR [sensitive, ls]	332	355	0.12
LRR [sensitive, ls]	332	355	1.3
LRR [sensitive, ls]	356	379	0.076
LRR [sensitive, ls]	356	379	0.83
LRR [sensitive, ls]	380	403	0.35
LRR [sensitive, ls]	380	403	3.8
LRR [sensitive, ls]	438	461	0.02
LRR [sensitive, ls]	438	461	0.22
LRR [sensitive, ls]	462	485	0.45
LRR [sensitive, ls]	462	485	4.9
LRR [sensitive, ls]	486	509	1.1
LRR [sensitive, ls]	486	509	12
LRR [sensitive, ls]	510	533	0.011
LRR [sensitive, ls]	510	533	0.13
LRR [sensitive, ls]	534	559	0.1
LRR [sensitive, ls]	534	559	1.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	8	560	1e-45
Xa21 [O. sativa]	8	708	1e-135
FLS2 [A.thaliana]	12	551	3e-68
Cf-9 [L. pimpinellifolium]	28	553	6e-36
Cf-9 [L. pimpinellifolium]	44	479	3e-29
FLS2 [A.thaliana]	50	909	3e-82
Cf-9 [L. pimpinellifolium]	51	552	1e-42
Cf-9 [L. pimpinellifolium]	117	550	1e-40
FLS2 [A.thaliana]	160	559	2e-52
Pto [L. esculentum]	582	844	7e-23
Rpg1 [Hordeum vulgare]	592	810	3e-22
Rpg1 [Hordeum vulgare]	592	810	3e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6651.m00113

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)