Report for 6657.m00179

 > 6657.m00179, length: 201, copies: 1 

MGAHSAAAALFTALLAFATLVSCNTEGDILYAQRQELKDINNVLASWDPTLVNPCTWVHVTCDNSNSVIRVDLGS

AGLSGSLIPQLGGLSNLQYLNLHGNNLTGTIPQSFGNLTNLVRLELQKNSLSGTIPASLGNIKTLKFLRLNGNSL

TGTLPLEVLSLVLVGNLTEIDCNYPGQTEDLRLRPRSGLIFSRMLENGSGK

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam fs]	91	114	1.2e-06
LRR [Pfam ls]	91	114	1.7e-05
LRR [Pfam ls]	115	138	0.13
LRR [Pfam ls]	139	163	0.8

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	67	90	3.4
LRR [sensitive, ls]	67	90	37
LRR [sensitive, ls]	91	114	1.5e-06
LRR [sensitive, ls]	91	114	1.7e-05
LRR [sensitive, ls]	115	138	0.012
LRR [sensitive, ls]	115	138	0.13
LRR [sensitive, ls]	139	163	0.073
LRR [sensitive, ls]	139	163	0.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	11	155	5e-18
CLV2 [A. thaliana]	34	187	3e-12
FLS2 [A.thaliana]	35	155	1e-13
FLS2 [A.thaliana]	43	165	4e-16
FLS2 [A.thaliana]	64	177	5e-11
FLS2 [A.thaliana]	64	181	1e-10
FLS2 [A.thaliana]	65	158	1e-10
Xa21 [O. sativa]	65	170	6e-14
FLS2 [A.thaliana]	71	167	6e-12
FLS2 [A.thaliana]	71	183	3e-11
FLS2 [A.thaliana]	78	162	5e-14
Xa21 [O. sativa]	78	179	1e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6657.m00179

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)