Report for 6657.m00181

 > 6657.m00181, length: 327, copies: 1 

MGSQFAGAKISVVLLTGLVALATLVNCNTEGDILYKQRVAWEDPHNVLQTWDPTLHNPCSWMRVMCNSDNTVILQ

FKVRIIVRFLLCRDLGDADISGPLIPQLGGLKNLQYLELYGNRLNGSIPAALGKMEHLVSLDLYSNLLTGTIPTS

LGAMSRLRYLRLSQNKLRGAIPPSLGNLMSLEDLELHKNALSGSIPASLGNVKTLNYLYMLIPKFANREITRYFF

TKLGTSKILLTYNSSFCLHKLHPPPQKRLNGNMLTGTVPLEILSLLVSNLVELNVANNNLDGTDRESGTRAAARI

CGPPVQEREKHIHVEENMDIRCKPQLR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	108	131	0.0039
LRR [Pfam ls]	132	155	0.052
LRR [Pfam ls]	156	179	0.017
LRR [Pfam ls]	180	203	0.27

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	108	131	0.00035
LRR [sensitive, ls]	108	131	0.0039
LRR [sensitive, ls]	132	155	0.0047
LRR [sensitive, ls]	132	155	0.052
LRR [sensitive, ls]	156	179	0.0015
LRR [sensitive, ls]	156	179	0.017
LRR [sensitive, ls]	180	203	0.024
LRR [sensitive, ls]	180	203	0.27
LRR [sensitive, ls]	274	297	2.5
LRR [sensitive, ls]	274	297	28

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	38	287	2e-12
FLS2 [A.thaliana]	43	287	2e-17
CLV2 [A. thaliana]	45	196	2e-11
Xa21 [O. sativa]	48	208	5e-21
FLS2 [A.thaliana]	82	293	1e-19
FLS2 [A.thaliana]	82	287	1e-14
CLV2 [A. thaliana]	85	205	4e-15
Xa21 [O. sativa]	85	287	6e-16
Cf-9 [L. pimpinellifolium]	89	288	2e-17
Cf-9 [L. pimpinellifolium]	89	205	3e-11
CLV2 [A. thaliana]	89	288	1e-10
FLS2 [A.thaliana]	89	288	1e-16
FLS2 [A.thaliana]	89	287	3e-15
Xa21 [O. sativa]	89	287	9e-17
Xa21 [O. sativa]	89	198	3e-11
Cf-9 [L. pimpinellifolium]	90	288	6e-11
FLS2 [A.thaliana]	90	288	2e-19
FLS2 [A.thaliana]	94	287	1e-21
FLS2 [A.thaliana]	94	280	2e-12
CLV2 [A. thaliana]	95	216	2e-11
Xa21 [O. sativa]	95	288	2e-16
FLS2 [A.thaliana]	96	285	1e-14
Xa21 [O. sativa]	110	249	3e-14

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6657.m00181

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)