Report for 6658.m00146

 > 6658.m00146, length: 1036, copies: 1 

MEYHNTTDENILLAFKAGLSNQSDVLSSWKKSTDFCQWPGVLCSLKHKHRVTVLNLSSESLAGTISPSIGNLTFL

KILDLSGNNLDGEIPSSIGRLARLQFLDLSNNSLHGDITSDLKNCTSLQGISLKSNYLTGEIPAWLGALPSLKLI

YLQKNSFTGSIPTSLANLSSLQEIYLTMNQLEGTIPEGFGRLSGLKNIHLGVNHLSGMIPTSIFNISSLSCFGVP

MNQLHGLLPSDLGIHLPKLQYLLLGYNHFTGSLPASIANSTEIYSLDISFNNFSGSIPPEIGTLCPDFLSFDTNQ

LIATTAEDWKFMTFLTNCTRLRILDLQDNMLGGVLPTSVSNLSAQLQLLYVGFNKISGNIPFGISNLVGLNQLQL

ANNQFTGTLPDNIGRLSFLHLLGIENNLLTGFIPSSVGNLTQLLRLSMDNNMLEGPLPTSIGNLQKITLALFARN

KFTGPLPREIFNLSSLSYALVLSGNYFVGPLPPEVGSLTNLAYLYISSNNLSGPLPNELSNCQSLIDLRLDQNLF

SGNIPETLSKLRGLTSLTLTKNTLSGVIPQELGLMDGMKELYLAHNNLSGHIPVSIGNMTSLNRLDLSFNHLDGE

VPSKGVLSNMTGFVFNGNLGLCGGIPELGLPPCPPVSMGHSLRKSHLVFRVVIPIVGTILFLSLMLAIFVLRKKP

KAQSKKTIGFQLIDDKYPRVSYAELVQGTNGFATDSLMGRGRYGSVYKCGLLLKSMMTTVAVKVFDLQQSGSSKS

FLAECEALSKIRHRNLINVITCCSSTDIKQNDFKAIVFEFMPNGSLDRWLHLDVTASQPPQGLTLIQRLNIAVDV

ADALDYLHNNCDPPIVHCDLKPSNILLDEDLVAHVGDFGLAKILADSEGEQPINSKSSIGIRGTIGYVAPEYGEG

GQVSPCGDAYSFGIVILELFTGMVPTHDMFRDGLTLQKHVKNVFPGILMKIVDPILLSIEGVYTSNLPPGRNAME

HMNHAILSIMKIALSCSRQAPTERMRIRDAAADLRRVRDSHVRGNEEHLELCSDVTNLASA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	74	97	0.11
LRR [Pfam ls]	98	121	0.014
LRR [Pfam ls]	122	145	2.9
LRR [Pfam ls]	146	169	0.42
LRR [Pfam ls]	170	193	0.91
LRR [Pfam ls]	243	266	0.47
LRR [Pfam ls]	267	290	0.92
LRR [Pfam ls]	320	343	0.069
LRR [Pfam ls]	345	368	0.83
LRR [Pfam ls]	369	392	1.3
LRR [Pfam ls]	393	416	0.83
LRR [Pfam ls]	417	440	3.8
LRR [Pfam ls]	490	513	0.22
LRR [Pfam ls]	514	537	4.9
LRR [Pfam ls]	562	585	0.13
LRR [Pfam ls]	586	611	1.1
Ser/Thr pkinase [Pfam fs]	707	928	5.9e-47
Ser/Thr pkinase [Pfam ls]	707	1005	2.1e-38

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	50	73	4.2
LRR [sensitive, ls]	50	73	46
LRR [sensitive, ls]	74	97	0.0097
LRR [sensitive, ls]	74	97	0.11
LRR [sensitive, ls]	98	121	0.0013
LRR [sensitive, ls]	98	121	0.014
LRR [sensitive, ls]	122	145	0.27
LRR [sensitive, ls]	122	145	2.9
LRR [sensitive, ls]	146	169	0.038
LRR [sensitive, ls]	146	169	0.42
LRR [sensitive, ls]	170	193	0.083
LRR [sensitive, ls]	170	193	0.91
LRR [sensitive, ls]	194	217	1.8
LRR [sensitive, ls]	194	217	19
LRR [sensitive, ls]	243	266	0.043
LRR [sensitive, ls]	243	266	0.47
LRR [sensitive, ls]	267	290	0.084
LRR [sensitive, ls]	267	290	0.92
LRR [sensitive, ls]	320	343	0.0063
LRR [sensitive, ls]	320	343	0.069
LRR [sensitive, ls]	345	368	0.075
LRR [sensitive, ls]	345	368	0.83
LRR [sensitive, ls]	369	392	0.12
LRR [sensitive, ls]	369	392	1.3
LRR [sensitive, ls]	393	416	0.076
LRR [sensitive, ls]	393	416	0.83
LRR [sensitive, ls]	417	440	0.35
LRR [sensitive, ls]	417	440	3.8
LRR [sensitive, ls]	490	513	0.02
LRR [sensitive, ls]	490	513	0.22
LRR [sensitive, ls]	514	537	0.45
LRR [sensitive, ls]	514	537	4.9
LRR [sensitive, ls]	538	561	1.1
LRR [sensitive, ls]	538	561	12
LRR [sensitive, ls]	562	585	0.011
LRR [sensitive, ls]	562	585	0.13
LRR [sensitive, ls]	586	611	0.1
LRR [sensitive, ls]	586	611	1.1

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	8	667	2e-61
Xa21 [O. sativa]	8	820	1e-166
FLS2 [A.thaliana]	12	627	2e-90
Cf-9 [L. pimpinellifolium]	28	593	5e-46
FLS2 [A.thaliana]	39	187	1e-17
Cf-9 [L. pimpinellifolium]	43	314	3e-20
Cf-9 [L. pimpinellifolium]	44	443	1e-24
Cf-9 [L. pimpinellifolium]	45	631	7e-53
FLS2 [A.thaliana]	61	1013	1e-138
Pto [L. esculentum]	694	956	7e-23
Rpg1 [Hordeum vulgare]	704	922	3e-22
Rpg1 [Hordeum vulgare]	704	922	3e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	648	670	out -> in

Report for 6658.m00146

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)