Report for 6660.m00252

 > 6660.m00252, length: 1305, copies: 1 

MLMRHPTIAAAAAAAASILLLMIAADGQAATTTPPSPPPAAIGNYCKPRERDALLAFKEGVTDDPAGLLASWRRG

GGQLQEDCCQWRGVRCSNRTGHVVKLRLRNDHAGTALAGEIGQSLISLEHLRYLDLSMNNLAGSTGHVPEFLGSF

RSLRYLNLSGIVFSGMVPPQLGNLSNLRYLDLSRIRLSGMVPFLYINDGSWLAHLSNLQYLKLDGVNLSTVVDWP

HVLNMIPSLKIVSLSSCSLQSANQSLPELSFKELEMLDLSNNDFNHPAESSWIWNLTSLKHLNLSSTSLYGDIPQ

ALGNMLSLQVLDFSFDDHKDSMGMSVSKNGKMGTMKANLKNLCNLEVLDLDCRLEYGNIMDIFQSLPQCSPSKLK

EVHLAGNSLTGMLPNWIGRLTSLVTLDLFNNSITGQVPSEIGMLTNLRNLYLHFNNMSGTITEKHFAHLTSLKSI

YLCYNHLKIVMDPQWLPPFKLEKAYFASITMGPSFPRWLQSQVDIVALAMNDAGINDTFPDWFSTTFSKAKLLEF

PGNQISGGLPTNMENMSLEKLYLKSNQIAGLIPRMPRNLTTLDLSNNSLSGPLPLNIGSPKLAELNLLSNRITGN

VPQSICELQNLHGLDLSNNLLDGEFPQCSGMSMMSFFRLSNNSFSGNFPSFLQGWTELSFLDLSWNKFSGNLPTW

IGNFSKLEILRLKHNMFSGNIPASITKLGNLSHLDLASNSISGPLPQYLANLTGMVPKQYYTNEHEERLSGCDYK

SLVTMKGLELEYDEENVTVVTIDLSSNLLTGVIPEDITYLHRLINLNLSSNYLSGKIPYSIGNMQSLESLDLSKN

MLYGEIPQSLSDLSSLSFLNLSYNNLVGGIPSGTQLGTLYDQNHHLYDGNDGLCGPPLQKSCYKSDASEQGHLMR

SKQGFDIGPFSIGVVMGFMAGLWIVFYALLFRKSWRVAYFCLLDKVYDESHYVEKILNRFGYIDSKPSPTPYDPS

LLLRKNKRIARNQLEYSQIIGSLMYLASATRPDISFAVSKLSRFTSNPGDDHWRALERVMRYLKGTVELGLHYTG

YPAVLEGYSDSNWISDVDEIKVTSGYVFTLGGGAVSWRSCKQTILTRSTMEAELTALDTATVEAEWLRDLLMDLP

VVEKPVPAILMNCDNQTTCEKTIEVCQEIKKLRSYNVGLHPNSEKPGRSLHEGTITKCDRQCIEGDGFETHMSYT

MVKIPDDIGAMKSLQSLDLSMNRISGEIPMSLSDLTFLSSLDLSCHNLVGRIPQGHQLDTLYPNNPSMYDGNGGL

CGPPLQRNCSAPKLGSQNTSVNDSRAKQMV

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	125	151	3.6
LRR [Pfam ls]	152	175	3.6
LRR [Pfam ls]	283	306	1.1
LRR [Pfam ls]	373	396	0.17
LRR [Pfam ls]	397	420	0.27
LRR [Pfam ls]	421	445	0.025
LRR [Pfam ls]	563	585	2.9
LRR [Pfam ls]	610	632	0.28
LRR [Pfam ls]	657	680	3.9
LRR [Pfam ls]	681	704	3.4
LRR [Pfam ls]	705	728	0.063
LRR [Pfam ls]	768	791	0.86
LRR [Pfam ls]	792	815	0.78
LRR [Pfam ls]	816	839	0.06
LRR [Pfam ls]	840	862	0.82
LRR [Pfam ls]	1213	1236	0.49

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	125	151	0.33
LRR [sensitive, ls]	125	151	3.6
LRR [sensitive, ls]	152	175	0.33
LRR [sensitive, ls]	152	175	3.6
LRR [sensitive, ls]	176	197	0.97
LRR [sensitive, ls]	176	197	11
LRR [sensitive, ls]	207	229	1.3
LRR [sensitive, ls]	207	229	14
LRR [sensitive, ls]	233	255	1.3
LRR [sensitive, ls]	233	255	14
LRR [sensitive, ls]	258	282	0.53
LRR [sensitive, ls]	258	282	5.8
LRR [sensitive, ls]	283	306	0.098
LRR [sensitive, ls]	283	306	1.1
LRR [sensitive, ls]	373	396	0.015
LRR [sensitive, ls]	373	396	0.17
LRR [sensitive, ls]	397	420	0.024
LRR [sensitive, ls]	397	420	0.27
LRR [sensitive, ls]	421	445	0.0023
LRR [sensitive, ls]	421	445	0.025
LRR [sensitive, ls]	446	470	1
LRR [sensitive, ls]	446	470	11
LRR [sensitive, ls]	519	539	6.6
LRR [sensitive, ls]	519	539	72
LRR [sensitive, ls]	542	561	0.51
LRR [sensitive, ls]	542	561	5.6
LRR [sensitive, ls]	563	585	0.27
LRR [sensitive, ls]	563	585	2.9
LRR [sensitive, ls]	586	609	1.3
LRR [sensitive, ls]	586	609	14
LRR [sensitive, ls]	610	632	0.025
LRR [sensitive, ls]	610	632	0.28
LRR [sensitive, ls]	633	656	4.3
LRR [sensitive, ls]	633	656	47
LRR [sensitive, ls]	657	680	0.36
LRR [sensitive, ls]	657	680	3.9
LRR [sensitive, ls]	681	704	0.31
LRR [sensitive, ls]	681	704	3.4
LRR [sensitive, ls]	705	728	0.0058
LRR [sensitive, ls]	705	728	0.063
LRR [sensitive, ls]	768	791	0.079
LRR [sensitive, ls]	768	791	0.86
LRR [sensitive, ls]	792	815	0.072
LRR [sensitive, ls]	792	815	0.78
LRR [sensitive, ls]	816	839	0.0054
LRR [sensitive, ls]	816	839	0.06
LRR [sensitive, ls]	840	862	0.075
LRR [sensitive, ls]	840	862	0.82
LRR [sensitive, ls]	1213	1236	0.044
LRR [sensitive, ls]	1213	1236	0.49
LRR [sensitive, ls]	1237	1259	7.8
LRR [sensitive, ls]	1237	1259	85

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	48	670	7e-45
FLS2 [A.thaliana]	50	930	2e-80
Xa21 [O. sativa]	53	697	1e-46
Cf-9 [L. pimpinellifolium]	83	924	1e-71
CLV2 [A. thaliana]	241	862	1e-49
Xa21 [O. sativa]	280	880	3e-49
Xa21 [O. sativa]	371	856	9e-38
Xa21 [O. sativa]	769	857	9e-12
Cf-9 [L. pimpinellifolium]	1204	1284	7e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	909	931	out -> in

Report for 6660.m00252

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)