Report for 6660.m00255

 > 6660.m00255, length: 672, copies: 1 

MISLPLLLFVLFFSALLLFPSSSDDDGGGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRR

HPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNHLSGKIPQELSRLIRLQQLVLNFNSLSGEIPAALGNLT

SLSVLELTNNTLSGAIPSSLGKLTGLTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLT

IFEVISNKLSGTLPTNAFSNLPSLHEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILD

VSHHNLEGSIPKEIGKLKNIVEFHADSNKLSGEIPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSG

EFDSQDGEITSLVAVKVLKLETPKALKSFTSECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLE

DWLHPETNDQAEQRHLTLHQRVTILLDVACALDHLHFHGPEPIVHCDIKSSNVLLDADMVAHVGDFGLARILIEG

SSLMQQSTSSMGIRGTIGYAAPEYGVGNTASTHGDIYSYGILVLETVTGMRPADSTFRTGLSLRQYVEPGLHGRL

MDVVDRKLGLDSEKWLQARDVSPCSSITECLVSLLRLGLSCSQELPSSRTQAGDVINELRAIKESLSMSSDM

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	103	126	0.11
LRR [Pfam ls]	127	150	0.047
LRR [Pfam ls]	151	174	0.055
LRR [Pfam ls]	175	198	3.5
LRR [Pfam ls]	223	247	1.3
LRR [Pfam ls]	343	366	1.8
Ser/Thr pkinase [Pfam ls]	368	636	2.1e-24
Ser/Thr pkinase [Pfam fs]	387	577	4.3e-39

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	79	102	0.65
LRR [sensitive, ls]	79	102	7.2
LRR [sensitive, ls]	103	126	0.0099
LRR [sensitive, ls]	103	126	0.11
LRR [sensitive, ls]	127	150	0.0043
LRR [sensitive, ls]	127	150	0.047
LRR [sensitive, ls]	151	174	0.005
LRR [sensitive, ls]	151	174	0.055
LRR [sensitive, ls]	175	198	0.32
LRR [sensitive, ls]	175	198	3.5
LRR [sensitive, ls]	199	222	0.65
LRR [sensitive, ls]	199	222	7.1
LRR [sensitive, ls]	223	247	0.12
LRR [sensitive, ls]	223	247	1.3
LRR [sensitive, ls]	270	294	2.1
LRR [sensitive, ls]	270	294	23
LRR [sensitive, ls]	295	318	7.3
LRR [sensitive, ls]	295	318	80
LRR [sensitive, ls]	319	342	2.2
LRR [sensitive, ls]	319	342	24
LRR [sensitive, ls]	343	366	0.16
LRR [sensitive, ls]	343	366	1.8

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Xa21 [O. sativa]	1	392	1e-152
CLV2 [A. thaliana]	6	374	1e-34
FLS2 [A.thaliana]	37	387	4e-50
Cf-9 [L. pimpinellifolium]	55	396	4e-28
CLV2 [A. thaliana]	79	368	9e-19
FLS2 [A.thaliana]	79	374	9e-48
Cf-9 [L. pimpinellifolium]	80	359	3e-22
FLS2 [A.thaliana]	80	193	8e-14
Xa21 [O. sativa]	80	473	2e-84
Cf-9 [L. pimpinellifolium]	82	373	2e-26
Cf-9 [L. pimpinellifolium]	83	312	8e-17
Cf-9 [L. pimpinellifolium]	83	260	2e-13
CLV2 [A. thaliana]	83	374	6e-28
FLS2 [A.thaliana]	83	663	6e-58
FLS2 [A.thaliana]	83	374	3e-42
FLS2 [A.thaliana]	83	387	4e-40
Cf-9 [L. pimpinellifolium]	85	374	8e-25
CLV2 [A. thaliana]	87	374	4e-29
FLS2 [A.thaliana]	88	428	6e-38
Xa21 [O. sativa]	92	410	2e-86
Pto [L. esculentum]	388	608	1e-18
Rpg1 [Hordeum vulgare]	388	574	2e-12
Rpg1 [Hordeum vulgare]	404	662	1e-18

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6660.m00255

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)