Report for 6682.m00130

 > 6682.m00130, length: 1029, copies: 1 

MHLRLLLLLVGVAAAAADADADADALLAAKAAMSDPTGALASWGGNGTRTNTTAAAAAHCAWAGVTCSSRGAVVG

LDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYLNLSNNAFNGSFPAALARLRGLRVLDL

YNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGKIPPELGNLTSLRELYIGYY

NSYSGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVL

TGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNRLTGT

LPPELCAGGKMHTLIALGNFLFGAIPDSLGECKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFPA

VSGAAAPNLGEISLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEI

GKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVPGTGQFS

YFNATSFVGNPGLCGPYLGPCRPGVAGTDHGGHGHGGLSNGVKLLIVLGLLACSIAFAVGAILKARSLKKASEAR

VWKLTAFQRLDFTCDDVLDCLKEENVIGKGGAGIVYKGAMPNGDHVAVKRLPAMGRGSSHDHGFSAEIQTLGRIR

HRHIVRLLGFCSNNETNLLVYEYMPNGSLGELLHGKKGGHLHWDTRYKIAIEAAKGLCYLHHDCSPLILHRDVKS

NNILLDSDFEAHVADFGLAKFLQDTGASECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVG

EFGDGVDIVQWVRMMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPKLAP

RQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKDQQQQQTNSESTTPPDLISI

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	120	143	0.21
LRR [Pfam ls]	144	165	0.67
LRR [Pfam ls]	168	191	8
LRR [Pfam ls]	192	215	0.11
LRR [Pfam ls]	241	264	0.47
LRR [Pfam ls]	265	288	7.3
LRR [Pfam ls]	289	312	0.0027
LRR [Pfam ls]	313	336	0.16
LRR [Pfam ls]	361	385	0.0048
LRR [Pfam ls]	458	481	0.25
LRR [Pfam ls]	530	553	0.0022
LRR [Pfam ls]	554	577	6.6
LRR [Pfam ls]	578	600	5.4
Ser/Thr pkinase [Pfam fs]	696	898	1.4e-47
Ser/Thr pkinase [Pfam ls]	696	966	3.6e-45

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	72	95	1.1
LRR [sensitive, ls]	72	95	35
LRR [sensitive, ls]	96	119	3
LRR [sensitive, ls]	96	119	95
LRR [sensitive, ls]	120	143	0.0068
LRR [sensitive, ls]	120	143	0.21
LRR [sensitive, ls]	144	165	0.022
LRR [sensitive, ls]	144	165	0.67
LRR [sensitive, ls]	168	191	0.26
LRR [sensitive, ls]	168	191	8
LRR [sensitive, ls]	192	215	0.0036
LRR [sensitive, ls]	192	215	0.11
LRR [sensitive, ls]	241	264	0.015
LRR [sensitive, ls]	241	264	0.47
LRR [sensitive, ls]	265	288	0.23
LRR [sensitive, ls]	265	288	7.3
LRR [sensitive, ls]	289	312	8.5e-05
LRR [sensitive, ls]	289	312	0.0027
LRR [sensitive, ls]	313	336	0.005
LRR [sensitive, ls]	313	336	0.16
LRR [sensitive, ls]	337	360	0.51
LRR [sensitive, ls]	337	360	16
LRR [sensitive, ls]	361	385	0.00015
LRR [sensitive, ls]	361	385	0.0048
LRR [sensitive, ls]	409	432	0.42
LRR [sensitive, ls]	409	432	13
LRR [sensitive, ls]	433	457	0.6
LRR [sensitive, ls]	433	457	19
LRR [sensitive, ls]	458	481	0.0081
LRR [sensitive, ls]	458	481	0.25
LRR [sensitive, ls]	482	505	0.58
LRR [sensitive, ls]	482	505	18
LRR [sensitive, ls]	506	529	0.58
LRR [sensitive, ls]	506	529	18
LRR [sensitive, ls]	530	553	7.1e-05
LRR [sensitive, ls]	530	553	0.0022
LRR [sensitive, ls]	554	577	0.21
LRR [sensitive, ls]	554	577	6.6
LRR [sensitive, ls]	578	600	0.17
LRR [sensitive, ls]	578	600	5.4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	3	596	9e-88
Xa21 [O. sativa]	18	784	1e-87
CLV2 [A. thaliana]	22	595	1e-61
FLS2 [A.thaliana]	37	970	1e-127
Cf-9 [L. pimpinellifolium]	49	594	7e-53
CLV2 [A. thaliana]	73	502	2e-43
Cf-9 [L. pimpinellifolium]	76	615	2e-54
Pto [L. esculentum]	681	964	2e-39
Rpg1 [Hordeum vulgare]	684	970	3e-27
Rpg1 [Hordeum vulgare]	690	970	6e-37

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 6682.m00130

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)