Report for 6797.m00114

 > 6797.m00114, length: 1109, copies: 1 

MAASVARVLLAAAVFFAAVAAAAAASSSAAAVAALMEFKTKLDDVDGRLSSWDAAGGSGGGDPCGWPGIACSAAM

EVTAVTLHGLNLHGELSAAVCALPRLAVLNVSKNALAGALPPGLAACRALEVLDLSTNSLHGGIPPSLCSLPSLR

QLFLSENFLSGEIPAAIGNLTALEELEIYSNNLTGGIPTTIAALQRLRIIRAGLNDLSGPIPVEISACASLAVLG

LAQNNLAGELPGELSRLKNLTTLILWQNALSGEIPPELGDIPSLEMLALNDNAFTGGVPRELGALPSLAKLYIYR

NQLDGTIPRELGDLQSAVEIDLSENKLTGVIPGELGRIPTLRLLYLFENRLQGSIPPELGELTVIRRIDLSINNL

TGTIPMEFQNLTDLEYLQLFDNQIHGVIPPMLGAGSNLSVLDLSDNRLTGSIPPHLCKFQKLIFLSLGSNRLIGN

IPPGVKACRTLTQLQLGGNMLTGSLPVELSLLRNLSSLDMNRNRFSGPIPPEIGKFRSIERLILSENYFVGQIPP

GIGNLTKLVAFNISSNQLTGPIPRELARCTKLQRLDLSKNSLTGVIPQELGTLVNLEQLKLSDNSLNGTVPSSFG

GLSRLTELQMGGNRLSGQLPVELGQLTALQIALNVSYNMLSGEIPTQLGNLHMLEFLYLNNNELEGEVPSSFGEL

SSLLECNLSYNNLAGPLPSTTLFQHMDSSNFLGNNGLCGIKGKSCSGLSGSAYASREAAVQKKRLLREKIISISS

IVIAFVSLVLIAVVCWSLKSKIPDLVSNEERKTGFSGPHYFLKERITFQELMKVTDSFSESAVIGRGACGTVYKA

IMPDGRRVAVKKLKCQGEGSNVDRSFRAEITTLGNVRHRNIVKLYGFCSNQDCNLILYEYMANGSLGELLHGSKD

VCLLDWDTRYRIALGAAEGLRYLHSDCKPKVIHRDIKSNNILLDEMMEAHVGDFGLAKLIDISNSRTMSAIAGSY

GYIAPEYAFTMKVTEKCDIYSFGVVLLELVTGQSPIQPLEQGGDLVNLVRRMTNSSTTNSEIFDSRLNLNSRRVL

EEISLVLKIALFCTSESPLDRPSMREVISMLMDARASAYDSFSSPASEAPIEDDSSLKH

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	124	147	0.041
LRR [Pfam ls]	148	171	0.02
LRR [Pfam ls]	172	195	0.52
LRR [Pfam ls]	220	243	5.8
LRR [Pfam ls]	244	267	0.46
LRR [Pfam ls]	268	291	3.7
LRR [Pfam ls]	292	315	1.2
LRR [Pfam ls]	316	339	5.7
LRR [Pfam ls]	340	363	0.017
LRR [Pfam ls]	364	387	0.23
LRR [Pfam fs]	412	435	4e-05
LRR [Pfam ls]	412	435	0.00067
LRR [Pfam ls]	460	483	0.29
LRR [Pfam ls]	484	507	1.5
LRR [Pfam ls]	508	531	0.23
LRR [Pfam ls]	556	579	0.025
LRR [Pfam ls]	580	603	0.013
LRR [Pfam ls]	604	627	0.24
LRR [Pfam ls]	653	676	0.17
Ser/Thr pkinase [Pfam fs]	808	1010	3.2e-50
Ser/Thr pkinase [Pfam ls]	808	1083	3.4e-48

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	100	123	0.41
LRR [sensitive, ls]	100	123	8.4
LRR [sensitive, ls]	124	147	0.002
LRR [sensitive, ls]	124	147	0.041
LRR [sensitive, ls]	148	171	0.00098
LRR [sensitive, ls]	148	171	0.02
LRR [sensitive, ls]	172	195	0.025
LRR [sensitive, ls]	172	195	0.52
LRR [sensitive, ls]	220	243	0.28
LRR [sensitive, ls]	220	243	5.8
LRR [sensitive, ls]	244	267	0.022
LRR [sensitive, ls]	244	267	0.46
LRR [sensitive, ls]	268	291	0.18
LRR [sensitive, ls]	268	291	3.7
LRR [sensitive, ls]	292	315	0.058
LRR [sensitive, ls]	292	315	1.2
LRR [sensitive, ls]	316	339	0.28
LRR [sensitive, ls]	316	339	5.7
LRR [sensitive, ls]	340	363	0.00083
LRR [sensitive, ls]	340	363	0.017
LRR [sensitive, ls]	364	387	0.011
LRR [sensitive, ls]	364	387	0.23
LRR [sensitive, ls]	388	411	0.74
LRR [sensitive, ls]	388	411	15
LRR [sensitive, ls]	412	435	3.2e-05
LRR [sensitive, ls]	412	435	0.00067
LRR [sensitive, ls]	436	459	0.53
LRR [sensitive, ls]	436	459	11
LRR [sensitive, ls]	460	483	0.014
LRR [sensitive, ls]	460	483	0.29
LRR [sensitive, ls]	484	507	0.075
LRR [sensitive, ls]	484	507	1.5
LRR [sensitive, ls]	508	531	0.011
LRR [sensitive, ls]	508	531	0.23
LRR [sensitive, ls]	532	555	0.46
LRR [sensitive, ls]	532	555	9.6
LRR [sensitive, ls]	556	579	0.0012
LRR [sensitive, ls]	556	579	0.025
LRR [sensitive, ls]	580	603	0.00062
LRR [sensitive, ls]	580	603	0.013
LRR [sensitive, ls]	604	627	0.011
LRR [sensitive, ls]	604	627	0.24
LRR [sensitive, ls]	653	676	0.0083
LRR [sensitive, ls]	653	676	0.17

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	8	1098	1e-160
Xa21 [O. sativa]	9	896	2e-97
CLV2 [A. thaliana]	33	673	3e-65
Cf-9 [L. pimpinellifolium]	64	722	8e-67
CLV2 [A. thaliana]	80	410	1e-34
CLV2 [A. thaliana]	303	754	5e-50
CLV2 [A. thaliana]	318	692	5e-45
CLV2 [A. thaliana]	336	723	4e-33
CLV2 [A. thaliana]	416	714	7e-34
Pto [L. esculentum]	791	1078	7e-40
Rpg1 [Hordeum vulgare]	798	1081	6e-41
Rpg1 [Hordeum vulgare]	801	1081	2e-30

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	13	35	in -> out
putative TM domain	746	768	out -> in

Report for 6797.m00114

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)