Report for 6820.m00134

 > 6820.m00134, length: 554, copies: 1 

LVTLDASNNQLAGPLPVEIGMLTGLNHLDLSYNNLAGDITEEHFANLRSLKYIDLSSNDPLNIVVDPTWIAPFRL

ERASFPACMMGPQFPTWLQWSVDIWLLEISNTGIKDKLPDWFWTTFSKLEELDMSNNQISVSGQLPPLPRKIVKL

DVSNNSLSGSLPSNFGAQNQQMVTLILSFNNLSGHIPESFCRMEQLAALDLANNLFEGELPQCFGMTGMAIVLLQ

NNRFSGSFPVFLERSTKLQLVDLSRNNFSGKLPTWIGDKKELVLLLLSHNVFSGIIPINITNLSNLRQLNLAGNS

LSGNIPWRLSNLEAMKEDNYIFNLDIPDDSSYNNLSVFTKRTELFYGPNIFSAVNIDLSSNYLVGQIPEEIASLA

LLKNLNLSRNYLSGKIPQKIGSLWSLESLDLSRNKLSGEIPPSLSNLSYLSDLDLSHNNLSGRIPSGSQLDTLYF

EHPDMYSSNDGLFGFPLQRNYSEGIAPKQGYHDHSKTRQVAEPMFFYLGLVSGFVVGLWVVFCTILFKKTWRIAY

FSLFDKACDKIYVFTVVTWARVSQKTNVQ

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	24	48	0.026
LRR [Pfam ls]	123	144	0.29
LRR [Pfam ls]	146	169	0.46
LRR [Pfam ls]	171	194	0.4
LRR [Pfam ls]	195	217	4
LRR [Pfam ls]	242	265	3.8
LRR [Pfam ls]	290	313	0.023
LRR [Pfam ls]	376	399	1.7
LRR [Pfam fs]	400	423	1.2e-05
LRR [Pfam ls]	400	423	0.00018
LRR [Pfam ls]	424	446	1.2

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	24	48	0.0024
LRR [sensitive, ls]	24	48	0.026
LRR [sensitive, ls]	49	74	0.99
LRR [sensitive, ls]	49	74	11
LRR [sensitive, ls]	98	122	4.2
LRR [sensitive, ls]	98	122	46
LRR [sensitive, ls]	123	144	0.027
LRR [sensitive, ls]	123	144	0.29
LRR [sensitive, ls]	146	169	0.042
LRR [sensitive, ls]	146	169	0.46
LRR [sensitive, ls]	171	194	0.036
LRR [sensitive, ls]	171	194	0.4
LRR [sensitive, ls]	195	217	0.36
LRR [sensitive, ls]	195	217	4
LRR [sensitive, ls]	242	265	0.34
LRR [sensitive, ls]	242	265	3.8
LRR [sensitive, ls]	266	289	0.51
LRR [sensitive, ls]	266	289	5.6
LRR [sensitive, ls]	290	313	0.0021
LRR [sensitive, ls]	290	313	0.023
LRR [sensitive, ls]	352	375	1.2
LRR [sensitive, ls]	352	375	13
LRR [sensitive, ls]	376	399	0.16
LRR [sensitive, ls]	376	399	1.7
LRR [sensitive, ls]	400	423	1.7e-05
LRR [sensitive, ls]	400	423	0.00018
LRR [sensitive, ls]	424	446	0.11
LRR [sensitive, ls]	424	446	1.2

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	439	4e-29
CLV2 [A. thaliana]	1	449	2e-42
CLV2 [A. thaliana]	1	439	5e-40
FLS2 [A.thaliana]	1	440	2e-46
FLS2 [A.thaliana]	1	450	2e-39
FLS2 [A.thaliana]	1	440	6e-39
Xa21 [O. sativa]	1	441	8e-40
Xa21 [O. sativa]	1	440	3e-35
Xa21 [O. sativa]	1	440	9e-33
Xa21 [O. sativa]	1	306	8e-18
CLV2 [A. thaliana]	6	448	3e-30
FLS2 [A.thaliana]	6	441	3e-38
Cf-9 [L. pimpinellifolium]	11	536	4e-53
FLS2 [A.thaliana]	57	441	3e-35
Xa21 [O. sativa]	144	441	7e-30
CLV2 [A. thaliana]	154	440	1e-25
Cf-9 [L. pimpinellifolium]	213	440	3e-12
CLV2 [A. thaliana]	213	441	2e-20
Xa21 [O. sativa]	255	443	2e-17
Xa21 [O. sativa]	356	450	1e-15

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	495	517	out -> in

Report for 6820.m00134

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)