Report for 873.m00168

 > 873.m00168, length: 940, copies: 1 

MPNLEHLNLSSNQFSGEIPASLAKLTKLQSVVLGSNLLHGGVPPVIGNISGLRTLELSGNPLGGAIPTTLGKLRS

LEHINVSLAGLESTIPDELSLCANLTVIGLAGNKLTGKLPVALARLTRVREFNVSKNMLSGEVLPDYFTAWTNLE

VFQADGNRFTGEIPTAITMASRLEFLSLATNNLSGAIPPVIGTLANLKLLDLAENKLAGAIPRTIGNLTSLETLR

LYTNKLTGRLPDELGDMAALQRLSVSSNMLEGELPAGLARLPRLVGLVAFDNLLSGAIPPEFGRNGQLSIVSMAN

NRFSGELPRGVCASAPRLRWLGLDDNQFSGTVPACYRNLTNLVRLRMARNKLAGDVSEILASHPDLYYLDLSGNS

FDGELPEHWAQFKSLSFLHLSGNKIAGAIPASYGAMSLQDLDLSSNRLAGEIPPELGSLPLTKLNLRRNALSGRV

PATLGNAARMEMLDLSGNALDGGVPVELTKLAEMWYLNLSSNNLSGEVPPLLGKMRSLTTLDLSGNPGLCGHDIA

GLNSCSSNTTTGDGHSGKTRLVLAVTLSVAAALLVSMVAVVCAVSRKARRAAVVVEKAETSASGGGGSSTAAAVQ

ASIWSKDTTFSFGDILAATEHFNDAYCIGKGSFGTVYRADLGGGRAVAVKRLDASETGDACWGVSERSFENEVRA

LTRVRHRNIVKLHGFCAMGGYMYLVYELAERGSLGAVLYGGGGGGGCRFDWPARMRAIRGVAHALAYLHHDCSPP

MIHRDVSVNNVLLDPDYEPRVSDFGTARFLVPGRSTCDSIAGSYGYMAPELAYMRVTTKCDVYSFGVVAMEMLMG

KYPGGLISSLQHSPQSLSAEGHDGSGGGGGEEASASASRRLLLKDVVDQRLDAPAGKLAGQVVFAFVVALSCVRT

SPDARPTMRAVAQELAARRRPILDRPFEMIKIGDLTNSHR

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam fs]	3	26	5e-05
LRR [Pfam ls]	3	26	0.00087
LRR [Pfam ls]	51	74	0.043
LRR [Pfam ls]	99	122	0.13
LRR [Pfam ls]	172	195	2.1
LRR [Pfam ls]	196	219	0.12
LRR [Pfam ls]	220	243	0.35
LRR [Pfam ls]	244	267	0.58
LRR [Pfam ls]	317	340	4
LRR [Pfam ls]	365	388	0.71
LRR [Pfam ls]	412	435	0.0022
LRR [Pfam ls]	459	482	3.8
LRR [Pfam ls]	483	506	0.39
LRR [Pfam ls]	507	531	1.9
Ser/Thr pkinase [Pfam fs]	622	823	4.5e-39
Ser/Thr pkinase [Pfam ls]	622	887	1.4e-33

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	3	26	3.7e-05
LRR [sensitive, ls]	3	26	0.00087
LRR [sensitive, ls]	27	50	0.56
LRR [sensitive, ls]	27	50	13
LRR [sensitive, ls]	51	74	0.0018
LRR [sensitive, ls]	51	74	0.043
LRR [sensitive, ls]	75	98	1.7
LRR [sensitive, ls]	75	98	40
LRR [sensitive, ls]	99	122	0.0056
LRR [sensitive, ls]	99	122	0.13
LRR [sensitive, ls]	123	147	0.51
LRR [sensitive, ls]	123	147	12
LRR [sensitive, ls]	148	168	2
LRR [sensitive, ls]	148	168	47
LRR [sensitive, ls]	172	195	0.091
LRR [sensitive, ls]	172	195	2.1
LRR [sensitive, ls]	196	219	0.0052
LRR [sensitive, ls]	196	219	0.12
LRR [sensitive, ls]	220	243	0.015
LRR [sensitive, ls]	220	243	0.35
LRR [sensitive, ls]	244	267	0.025
LRR [sensitive, ls]	244	267	0.58
LRR [sensitive, ls]	268	291	2
LRR [sensitive, ls]	268	291	47
LRR [sensitive, ls]	292	316	0.49
LRR [sensitive, ls]	292	316	12
LRR [sensitive, ls]	317	340	0.17
LRR [sensitive, ls]	317	340	4
LRR [sensitive, ls]	341	364	0.88
LRR [sensitive, ls]	341	364	21
LRR [sensitive, ls]	365	388	0.03
LRR [sensitive, ls]	365	388	0.71
LRR [sensitive, ls]	389	409	0.74
LRR [sensitive, ls]	389	409	17
LRR [sensitive, ls]	412	435	9.3e-05
LRR [sensitive, ls]	412	435	0.0022
LRR [sensitive, ls]	459	482	0.16
LRR [sensitive, ls]	459	482	3.8
LRR [sensitive, ls]	483	506	0.017
LRR [sensitive, ls]	483	506	0.39
LRR [sensitive, ls]	507	531	0.081
LRR [sensitive, ls]	507	531	1.9

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	542	3e-49
Cf-9 [L. pimpinellifolium]	1	514	1e-43
CLV2 [A. thaliana]	1	448	3e-45
FLS2 [A.thaliana]	1	516	4e-71
CLV2 [A. thaliana]	3	520	3e-58
FLS2 [A.thaliana]	4	919	1e-117
FLS2 [A.thaliana]	4	516	5e-69
Xa21 [O. sativa]	4	709	2e-78
CLV2 [A. thaliana]	7	541	9e-50
FLS2 [A.thaliana]	7	516	2e-69
Cf-9 [L. pimpinellifolium]	49	516	6e-35
CLV2 [A. thaliana]	54	516	1e-46
Cf-9 [L. pimpinellifolium]	117	516	6e-33
CLV2 [A. thaliana]	156	555	1e-42
Xa21 [O. sativa]	157	516	1e-44
Cf-9 [L. pimpinellifolium]	165	511	2e-20
Xa21 [O. sativa]	172	516	3e-43
FLS2 [A.thaliana]	312	516	7e-18
CLV2 [A. thaliana]	320	516	1e-13
Xa21 [O. sativa]	337	499	2e-20
Rpg1 [Hordeum vulgare]	606	922	9e-25
Pto [L. esculentum]	610	915	5e-30
Rpg1 [Hordeum vulgare]	610	826	3e-22

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	547	569	out -> in
putative TM domain	684	701	in -> out

Report for 873.m00168

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)