Report for 873.m00174

 > 873.m00174, length: 535, copies: 1 

MAGVVHRFLLLLLFVAAAVMPASTNAAASSQTDALLAWKASLTDVAALSAWTRAAPVCGWRGVACDAAGLVARLR

LPSLGLRGGLDELDFAALPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLY

NNNFVGNIPHQLSWLPKITHFDLGNNWLTNPDYRKFSTMPTVKFLSLFANSLNGSFPEFFLRSSSITYLDLSLNN

FSGSIPDLLPEKLPNLTHLNLSINAFSGRIPDSLRSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLT

SLKYLDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSSGSAFCRLLSLE

NLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGEISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSL

DFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNLTSMKNKKL

NISSGIITMA

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	95	118	0.084
LRR [Pfam ls]	119	142	0.31
LRR [Pfam ls]	143	166	1.5
LRR [Pfam ls]	215	239	0.13
LRR [Pfam ls]	240	260	0.89
LRR [Pfam ls]	277	300	0.032
LRR [Pfam ls]	301	324	0.0029
LRR [Pfam ls]	325	349	0.2
LRR [Pfam ls]	373	396	0.0045
LRR [Pfam ls]	422	445	1.6
LRR [Pfam ls]	446	470	4.2
LRR [Pfam ls]	471	494	1
LRR [Pfam fs]	495	518	1.3e-05
LRR [Pfam ls]	495	518	0.00021

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	95	118	0.0036
LRR [sensitive, ls]	95	118	0.084
LRR [sensitive, ls]	119	142	0.013
LRR [sensitive, ls]	119	142	0.31
LRR [sensitive, ls]	143	166	0.064
LRR [sensitive, ls]	143	166	1.5
LRR [sensitive, ls]	167	190	0.66
LRR [sensitive, ls]	167	190	15
LRR [sensitive, ls]	191	214	3.3
LRR [sensitive, ls]	191	214	78
LRR [sensitive, ls]	215	239	0.0057
LRR [sensitive, ls]	215	239	0.13
LRR [sensitive, ls]	240	260	0.038
LRR [sensitive, ls]	240	260	0.89
LRR [sensitive, ls]	277	300	0.0014
LRR [sensitive, ls]	277	300	0.032
LRR [sensitive, ls]	301	324	0.00012
LRR [sensitive, ls]	301	324	0.0029
LRR [sensitive, ls]	325	349	0.0084
LRR [sensitive, ls]	325	349	0.2
LRR [sensitive, ls]	373	396	0.00019
LRR [sensitive, ls]	373	396	0.0045
LRR [sensitive, ls]	397	419	0.34
LRR [sensitive, ls]	397	419	8
LRR [sensitive, ls]	422	445	0.07
LRR [sensitive, ls]	422	445	1.6
LRR [sensitive, ls]	446	470	0.18
LRR [sensitive, ls]	446	470	4.2
LRR [sensitive, ls]	471	494	0.044
LRR [sensitive, ls]	471	494	1
LRR [sensitive, ls]	495	518	8.9e-06
LRR [sensitive, ls]	495	518	0.00021

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
CLV2 [A. thaliana]	9	512	1e-50
Xa21 [O. sativa]	9	529	3e-56
FLS2 [A.thaliana]	31	525	2e-57
Cf-9 [L. pimpinellifolium]	50	512	3e-37
Cf-9 [L. pimpinellifolium]	73	525	8e-43
Cf-9 [L. pimpinellifolium]	74	438	8e-25
FLS2 [A.thaliana]	74	364	5e-29
Xa21 [O. sativa]	81	431	1e-34
FLS2 [A.thaliana]	86	525	3e-56
CLV2 [A. thaliana]	87	272	2e-11
CLV2 [A. thaliana]	88	365	1e-28
FLS2 [A.thaliana]	88	533	3e-56
FLS2 [A.thaliana]	89	531	1e-58
FLS2 [A.thaliana]	93	533	1e-51
CLV2 [A. thaliana]	96	510	6e-35
CLV2 [A. thaliana]	96	470	5e-33
CLV2 [A. thaliana]	222	533	4e-21

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	7	29	in -> out

Report for 873.m00174

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)