Report for 873.m00175

 > 873.m00175, length: 441, copies: 1 

KLGALTFLDLSKNRLSGKIPRELGNLVQLQTLLDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWY

LQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGNNNFFGDIPIWIGKGL

PSLKILSLKSNNFSGEIPSELSQLSQLQLLDMTNNGLTGLIPRSFGKLTSMKNPKLISSRELLQWSFNHDRINTI

WKGKEQIFEIKTYAIDIQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSS

NELSGAIPPSLAGISTLSSLNLSNNHLSGKISTGNQLQTLTDPSIYSNNSGLCGLPLNISCTNYALASDERYCRT

CEDQYLSYFVMAGVVFGSWLWFGMLFSIGNLRYAVFCFVDDIQRKVMQKVSCINQLLSRGNTAQYL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
LRR [Pfam ls]	4	27	0.032
LRR [Pfam ls]	54	77	0.08
LRR [Pfam ls]	78	99	0.39
LRR [Pfam ls]	103	126	0.46
LRR [Pfam ls]	127	151	5.4
LRR [Pfam ls]	152	175	0.23
LRR [Pfam fs]	176	199	2.2e-05
LRR [Pfam ls]	176	199	0.00036
LRR [Pfam ls]	268	291	0.043
LRR [Pfam ls]	292	315	0.0045
LRR [Pfam ls]	316	338	4

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value
LRR [sensitive, ls]	4	27	0.0014
LRR [sensitive, ls]	4	27	0.032
LRR [sensitive, ls]	54	77	0.0034
LRR [sensitive, ls]	54	77	0.08
LRR [sensitive, ls]	78	99	0.017
LRR [sensitive, ls]	78	99	0.39
LRR [sensitive, ls]	103	126	0.02
LRR [sensitive, ls]	103	126	0.46
LRR [sensitive, ls]	127	151	0.23
LRR [sensitive, ls]	127	151	5.4
LRR [sensitive, ls]	152	175	0.0097
LRR [sensitive, ls]	152	175	0.23
LRR [sensitive, ls]	176	199	1.5e-05
LRR [sensitive, ls]	176	199	0.00036
LRR [sensitive, ls]	244	267	0.59
LRR [sensitive, ls]	244	267	14
LRR [sensitive, ls]	268	291	0.0018
LRR [sensitive, ls]	268	291	0.043
LRR [sensitive, ls]	292	315	0.00019
LRR [sensitive, ls]	292	315	0.0045
LRR [sensitive, ls]	316	338	0.17
LRR [sensitive, ls]	316	338	4

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
Cf-9 [L. pimpinellifolium]	1	361	2e-46
Cf-9 [L. pimpinellifolium]	1	331	1e-19
CLV2 [A. thaliana]	1	360	1e-34
FLS2 [A.thaliana]	1	354	3e-42
CLV2 [A. thaliana]	2	331	2e-34
Xa21 [O. sativa]	2	349	2e-37
Xa21 [O. sativa]	2	331	4e-29
Xa21 [O. sativa]	2	205	3e-16
Cf-9 [L. pimpinellifolium]	5	341	1e-29
CLV2 [A. thaliana]	5	353	4e-38
FLS2 [A.thaliana]	5	349	2e-37
FLS2 [A.thaliana]	5	331	8e-36
Xa21 [O. sativa]	8	354	2e-29
FLS2 [A.thaliana]	48	349	1e-24
Cf-9 [L. pimpinellifolium]	58	331	7e-20
FLS2 [A.thaliana]	60	349	5e-27
CLV2 [A. thaliana]	104	331	2e-14
Xa21 [O. sativa]	104	347	1e-19
Xa21 [O. sativa]	127	348	2e-19
Xa21 [O. sativa]	241	360	1e-12

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation
putative TM domain	392	414	out -> in

Report for 873.m00175

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)