Report for 903.m00125

 > 903.m00125, length: 365, copies: 1 

MWQRYRFLCCGCGGNMAASAAGDRGCDDDADCGGGSGGGGFGEEEEGGKGGVAGAARRLSWAQVEAMTGGFTSAV

VGEGGFSTVYLARVAGALAAVKVHRSSERLHRVFRQELDALLRVRHPHIVRLLAFCEQQEEGVLVLEFAANGNLH

ERLHGGGKAAGTMPWARRASVALQVARALEYLHDRCEPAVVHGDVKASNVLLDEAMSAKLCDFGSARMGFSAAVR

PRSSAHTMLGSPGYVDPHYIRSGMVTKKSDVYSFGVLLLELLTGMEAFCAAEGRLLTAVLAPRLRPASCAACDAR

MLVDERLGSAYDAGEASAVASLAASCVGENPSLRPSMADVVRALEQGAHGSISAVARRSDGHGKL

HMM searches against classifier domains (fs and ls)

Domain	Begin	End	E-value
Ser/Thr pkinase [Pfam ls]	70	341	5e-45
Ser/Thr pkinase [Pfam fs]	75	273	6e-49

Searches for specific additional domains (secondary HMMs)

Domain	Begin	End	E-value

BLAST searches against classifier sequences

Query sequence	Begin	End	E-value
FLS2 [A.thaliana]	57	268	1e-24
Rpg1 [Hordeum vulgare]	57	344	2e-23
Pto [L. esculentum]	58	345	2e-32
Rpg1 [Hordeum vulgare]	64	346	6e-13

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)

Domain	Begin	End	E-value

NCOILSv2.0 search for coiled-coil domains

Domain	Begin	End

TM-HMM search for transmembrane domains

Domain	Begin	End	Orientation

Report for 903.m00125

HMM searches against classifier domains (fs and ls)

Searches for specific additional domains (secondary HMMs)

BLAST searches against classifier sequences

HMM search against whole Pfam_ls HMM database(excluding classifier domains, except LRR)

NCOILSv2.0 search for coiled-coil domains

TM-HMM search for transmembrane domains

HMM search against whole Pfam_ls HMM database
(excluding classifier domains, except LRR)